IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Neddylation and deneddylation of CUL-3 is required to target MEI-1/Katanin for degradation at the meiosis-to-mitosis transition in C. elegans. Neddylation and deneddylation of CUL-3 is required to target MEI-1/Katanin for degradation at the meiosis-to-mitosis transition in C. elegans. Curr. Biol. (0960-9822) 2003 imex curation Pintard L., Kurz T., Glaser S., Willis JH., Peter M., Bowerman B. Several interactions cannot be entered for the Y2H assay as the bait/prey relationships are not stated. "It is important to note that several interactions were found to be positive in one direction but not in the other." (Fig 1B) -it is not stated which the positive directions were. bbowerman@molbio.uoregon.edu, matthias.peter@bc.biol.ethz.ch 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pintard L., Kurz T., Glaser S., Willis JH., Peter M., Bowerman B. Several interactions cannot be entered for the Y2H assay as the bait/prey relationships are not stated. "It is important to note that several interactions were found to be positive in one direction but not in the other." (Fig 1B) -it is not stated which the positive directions were. Several interactions cannot be entered for the Y2H assay as the bait/prey relationships are not stated. "It is important to note that several interactions were found to be positive in one direction but not in the other." (Fig 1B) -it is not stated which the positive directions were. bbowerman@molbio.uoregon.edu, matthias.peter@bc.biol.ethz.ch Accepted 2011-JUN-30 by JYOTI 26-Sep-2011: Contacted by JYOTI. Curr. Biol. (0960-9822) 2003 jyoti Only protein-protein interactions imex curation csn1_caeel COP9 signalosome complex subunit 1 Y59A8A.1 csn-1 protein protein caeel Caenorhabditis elegans MQNELLDDPMDTGAPAAEAAAADEPLPPAHGIDREVTPKPAGNPDLMQQSLDNPAIPMHLIEKRDDRRESCDDGYSLTVNESAIDIESLACSYDSNAFFLRARFIARHCPILRADAYISLINYLKEHTTDITHYVAFFNELESELARKEFKNRQLNFQIPLRDQKWIEENGATWQSTTDQLQAEYKRHKDEGVKESTRRAMEDLFQHYMMAGKIDEAIRLYSRGIRDYCTQLKHSINMWINWMEVAICANDWGKLDTVTNTAYRSLKDADDAEKNSQQSQQAPPQRGENAPYMVERDPNAPIQTLTNRQLIETALAKCLAAQVLLKLRNKRYSQVVETILQIKTECLQSKWFVTSSDLGIYGMLSAMATMSRADLKLQVSGNGTFRKLLESEPQLIELLGSYTSSRFGRCFEIMRSVKPRLLLDPFISRNVDELFEKIRQKCVLQYLQPYSTIKMATMAEAVGMSSAELQLSLLELIEQKHVSLKIDQNEGIVRILDERDENAILKRVNVTCDRATQKAKSLLWKTTLAGANIHSISDKETRPKRKNQKESAKFDRNFGGIDVDEDPRGIAGPSGLSDDFNIAYDQQPQQQVQYLEDLGDI CBF1ED041363688A csn6_caeel COP9 signalosome complex subunit 6 Y67H2A.6 csn-6 protein protein caeel Caenorhabditis elegans MALNAPSGSCSSKVLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEPVTFSTEHLLQRADQYLEVFPELQVIGLYCAGEDDNLTPEEKPLLSKLTNAVRNSEKAGQIDATLFLKLNSITAGTTRKLPLFAFEADVTDQEKHKPIEWILVSEESERVGVNHIAKLSTKHGKDGKSVGKKHAEAQDAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKEANLLAQKLKTIDRYAAEFTDSFEKEEKTMTVFSLMPRLTTLLGNMQNVWNKLSAQRADLLADDGFHGKSTSRWAHPVRFKSQHLGRPQQADDDDYFDDEDLENDMSGPRRKIHAADSPAGSRRRRVPPRAMNFLGRNSGMQAATDEMELSGQEENMGSNYIPDVPRPSATAHNESDESSQAS 5E62AE7D089426A0 csn2_caeel COP9 signalosome complex subunit 2 B0025.2 csn-2 protein protein caeel Caenorhabditis elegans MGDEYMDDDEDYGFEYEDDSGSEPDVDMENQYYTAKGLRSDGKLDEAIKSFEKVLELEGEKGEWGFKALKQMIKITFGQNRLEKMLEYYRQLLTYIKSAVTKNYSEKSINAILDYISTSRQMDLLQHFYETTLDALKDAKNERLWFKTNTKLGKLFFDLHEFTKLEKIVKQLKVSCKNEQGEEDQRKGTQLLEIYALEIQMYTEQKNNKALKWVYELATQAIHTKSAIPHPLILGTIRECGGKMHLRDGRFLDAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLIKSDINPFDSQEAKPFKNEPEIVAMTQMVQAYQDNDIQAFEQIMAAHQDSIMADPFIREHTEELMNNIRTQVLLRLIRPYTNVRISYLSQKLKVSQKEVIHLLVDAILDDGLEAKINEESGMIEMPKNKKKMMVTSLVVPNAGDQGTTKSDSKPGTSSEPSTTTSVTSSILQGPPATSSCHQELSMDGLRVWAERIDSIQSNIGTRIKF 8959D0E5D4821B4C rbx1_caeel RING-box protein 1 rbx-1 Ce-rbx-1 ZK287.5 protein protein caeel Caenorhabditis elegans MAQASDSTAMEVEEATNQTVKKRFEVKKWSAVALWAWDIQVDNCAICRNHIMDLCIECQANQAAGLKDECTVAWGNCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH EFE50F7684B30A56 csn4_caeel COP9 signalosome complex subunit 4 Y55F3AM.15 csn-4 protein protein caeel Caenorhabditis elegans MSGEIERSQEVAVIFAQDTDHKAQYEALAKLCNKYLPQNAMGRVDTAEIIKIIDTVIALETGSMVVSRQFVSLITERLDNQHLESECVKAISEGILAIIKTRTISYEDQVCILRLMLASLYEKEGRIKDAAQALIAINSDTSPKFNGPQAAKEGAKAQLCIRITKLLLDCSEIDEAEQYVNRTSILMVDLGANPDIQIEHKALQARVSDAKRRFVEAAQRYYELSATEQLPNSDKLTALGKAIVCVLLAKPGPQRSRLLTLIFKDERAPKCASFELIAKMYLTKVIHKDELEEFEHQLQDHQKADEHGESILKGVIQEHNITAISQLYINISFKTLGQLLGVDTEAAESMAGEMISSERLHGYIDQTNGILHFEDSNPMRVWDSQILSTLEQINKVSDMIVARHSEFAEFLT 9BBB0EA566B923F9 csn3_caeel COP9 signalosome complex subunit 3 Y38C1AA.2 csn-3 protein protein caeel Caenorhabditis elegans MTTFFNKLFTGASSSSSAAASSGMDLGSMESLCAAINELCSEKHVSENVGELAAGIVRKNKELFEKKSNDVEAFLLHCSPNVGSAAMVAAIKGMFDTSAAKNNETGTDRAVELLNHYVDENNFVGGHLKLVPEIIFPLLRDVGLYCLEKKNKPEIGQRIIMKALGSMFPRNGSNAPNVLTSAHGVLFACALETKDYASVEPFIDLHVDEIANENCIQDQEKSDNRERDFGDVFLGRMKKGAAFGSQPVAHNPHLHPKYVLDYLYNGACILIELKRFEDALFLLEICVGMPAFSVQDQHLDSFKKYVLISLILKGKVDVTENGDKSAIRHFKTKSPEYKQFSEIRFSRSSNTHSAVESLVKSAKDRLRKDGNTEIAKYLVVEMKKKTIMSLTRMFTSIRISEIEELAFLKSRDQVTELIGQLVEEQRITVRIDGDMVFWTELSPVPSKNDVENKIRIVDHLNTLLHEKNTTMKAGSGRMRPSVMYNEDEGLSMPPTESKFFS 0D204CFCF1ACBD61 csn5_caeel COP9 signalosome complex subunit 5 B0547.1 JAB1 homolog csn-5 protein protein caeel Caenorhabditis elegans MEVDNVKPSSSVPQRNWEKENNVQNVDSIFEYNNKQQVEIRNAKPWDKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTETRVNAQAQAYEYMTVYSEMCDTEGRKEKVVGWYHSHPGYGCWLSGIDVSTQTLNQKFQEPWVAIVIDPLRTMSAGKVDIGAFRTYPEGYRPPDDVPSEYQSIPLAKIEDFGVHCKRYYSLDVSFFKSQLDAHILTSLWNSYWISTLSSSPLFSNVEFLNNQIQDINQKLSAVDKKLQLNDRSVDGHEALMKVVTDAKAVGDELETGRISHLVKQLLFARQAGGGCGCSHASAGSPMDIAVATEPEKAGPSPSAPEPAVEMADA 0DA27521156E0E70 csn_1-csn_1 1 2 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_1-csn_2 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_1-csn_4 1 6 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_1-csn_5 1 2 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig 1A csn_2-csn_1 1 2 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig 1B csn_2-csn_4 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig 1B csn_2-csn_6 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig 1B csn_2-csn_3 1 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig 1B csn_3-csn_2 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_3-csn_3 1 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_3-csn_4 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_4-csn_2 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 1A csn_6-csn_2 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 1A csn_6-csn_4 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 1A csn_1-csn_5-2 1 5 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig 4D csn_6-rbx_1 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 4D