UniProt UniProt http://www.uniprot.org Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Cell Res. (1001-0602) 2003 mimix curation Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp 14-Mar-2012: Contacted by JYOTI. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Accepted 2012-JAN-03 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cell Res. (1001-0602) 2003 mimix curation Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Cell Res. (1001-0602) 2003 mimix curation Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp 14-Mar-2012: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Accepted 2012-JAN-03 by ORCHARD Cell Res. (1001-0602) 2003 mimix curation Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). Cell Res. (1001-0602) 2003 mimix curation Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp 14-Mar-2012: Contacted by JYOTI. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Accepted 2012-JAN-03 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cell Res. (1001-0602) 2003 mimix curation t2fa_human General transcription factor IIF subunit 1 Transcription initiation factor IIF subunit alpha GTF2F1 RAP74 Transcription initiation factor RAP74 General transcription factor IIF 74 kDa subunit protein protein human Homo sapiens Human MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE DIP protein P35269 original sequence version: 109 DIP protein P35269 original sequence version: 171 DIP protein P35269 original sequence version: 164 1032B04A36BDC24F t2fb_human General transcription factor IIF subunit 2 GTF2F2 RAP30 Transcription initiation factor IIF subunit beta ATP-dependent helicase GTF2F2 Transcription initiation factor RAP30 General transcription factor IIF 30 kDa subunit protein protein human Homo sapiens Human MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD DIP protein P13984 original sequence version: 112 DIP protein P13984 original sequence version: 172 DIP protein P13984 original sequence version: 165 05A1A9F8D31B749C rmp_human Unconventional prefoldin RPB5 interactor 1 URI1 C19orf2 NNX3 PPP1R19 Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RMP RNA polymerase II subunit 5-mediating protein URI protein protein human Homo sapiens Human MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD DBB046A392E3C752 rpab1_human DNA-directed RNA polymerases I, II, and III subunit RPABC1 POLR2E DNA-directed RNA polymerase II subunit E RPB5 homolog DNA-directed RNA polymerase II 23 kDa polypeptide XAP4 protein protein human Homo sapiens Human MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ DIP protein P19388 original sequence version: 112 DIP protein P19388 original sequence version: 175 1E88AFDBCF9C8535 rmp-gtf2f1 2 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 2A rmp-gtf2f2 2 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 2B rmp-polr2e 2 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 2C gtf2f1-rmp 3 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 3A gtf2f2-rmp-1 3 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 3B rmp-gtf2f1-4 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 4B rmp-gtf2f2 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 4C