MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle. Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle. Mol. Cell. Biol. (0270-7306) 2003 Dryden SC., Nahhas FA., Nowak JE., Goustin AS., Tainsky MA. suggested by lperfetto partial coverage rapid curation human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Dryden SC., Nahhas FA., Nowak JE., Goustin AS., Tainsky MA. suggested by lperfetto Mol. Cell. Biol. (0270-7306) 2003 partial coverage rapid curation Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle. Role for human SIRT2 NAD-dependent deacetylase activity in control of mitotic exit in the cell cycle. Mol. Cell. Biol. (0270-7306) 2003 Dryden SC., Nahhas FA., Nowak JE., Goustin AS., Tainsky MA. suggested by lperfetto partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dryden SC., Nahhas FA., Nowak JE., Goustin AS., Tainsky MA. suggested by lperfetto Mol. Cell. Biol. (0270-7306) 2003 partial coverage rapid curation sir2_human NAD-dependent protein deacetylase sirtuin-2 SIR2-like protein 2 SIRT2 SIR2L SIR2L2 Regulatory protein SIR2 homolog 2 protein protein human Homo sapiens Human MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTEREKPQ DIP protein Q8IXJ6 original sequence version: 113 A392442A8F6316F1 cc14b_human Dual specificity protein phosphatase CDC14B CDC14B CDC14 cell division cycle 14 homolog B protein protein human Homo sapiens Human MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR CEE15EC4DC3B1DC7 sirt2-cdc14b 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association homomint f5e mint sirt2-cdc14b-1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association homomint f5e mint