UniProt UniProt http://www.uniprot.org The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3. EMBO J. (0261-4189) 2000 mimix curation Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de 26-Sep-2011: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rodel B., Tavassoli K., Karsunky H., Schmidt T., Bachmann M., Schaper F., Heinrich P., Shuai K., Elsasser H.P., Moroy T. moereoey@uni-essen.de Accepted 2011-JUL-08 by ORCHARD 26-Sep-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard mimix curation pias3_human E3 SUMO-protein ligase PIAS3 Protein inhibitor of activated STAT protein 3 PIAS3 E3 SUMO-protein transferase PIAS3 protein protein human Homo sapiens Human MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD 7C06EF599D48F87D pias3_mouse E3 SUMO-protein ligase PIAS3 Pias3 Protein inhibitor of activated STAT protein 3 E3 SUMO-protein transferase PIAS3 protein protein mouse Mus musculus Mouse MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPGSKGALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSGPSLTGCRSDVISLD 2827F52715F0E549 gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 63AB726025300B6B gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 gfi1-pias3 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1 gfi1-pias3-1 6 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2 gfi1-pias3-2 3 9 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction 3a gfi1-pias3-3 5 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction 3b pias3-gfi1 5 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait direct interaction direct interaction 3b pias3-gfi1-1 1 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4 gfi1-pias3-4 4 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 and 6