IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. J. Biol. Chem. (0021-9258) 1999 imex curation Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp Accepted 2011-NOV-18 by JYOTI J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. J. Biol. Chem. (0021-9258) 1999 imex curation Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp Accepted 2011-NOV-18 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P46097 original sequence version: 113 DIP protein P46097 original sequence version: 117 B4BD13FF70E0481B syt10_mouse Synaptotagmin-10 Syt10 Synaptotagmin X protein protein mouse Mus musculus Mouse MSFRKEDGVSSLCQKALHIITELCFAGQVEWDKCSGIFPADRSGQGGGGTDISVSLLAVVVSFCGLALLVVSLFVFWKLCWPCWKSKLVAPNLSVLPQSISSAPTEVFETEEKKEVEENEKPAPKAIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQTTEPTSSSRHNSFRRHLPRQMNVSSVDFSVGTEPILQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFALQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPVVYDQLSNRKLHFSIYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLCIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCSSPRPPSTP 1F551F4EF75A0A9B syt1_mouse Synaptotagmin-1 Synaptotagmin I p65 Syt1 protein protein mouse Mus musculus Mouse MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P46096 original sequence version: 132 7FDEFF37170BD169 syt6_mouse Synaptotagmin-6 Syt6 Synaptotagmin VI protein protein mouse Mus musculus Mouse MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCRSFELQSPEQSPSAADSGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRKKEASSPSSANPASETLQSPSSRGNMADKLKDPSALGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAAEQPTSIGRIKPELYKQKSVDGDDAKSEAAKSCGKINFSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPIYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGINAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGTPRL C37C9305E3D05572 syt8_mouse Synaptotagmin-8 Syt8 Synaptotagmin VIII protein protein mouse Mus musculus Mouse MQADRSMKMGHALNPFSTSAPLDATAGPSLIPDLITRIPWPRWTLFIAILAAGVLLVSCLLCVICCYCHRHRHRKQPKDKETVGLGSARNSTTTHLVQPDVDCLEPCSGGDQQWGRLLLSLEYDFGSQEIRVGLRQAGNLKAEGTADPYAWVSVSTQSGRRHETKVHRGTLSPMFEETCCFLVPPAELPKATLKVQLWDFKRFSEHEPLGELQLPLGTVDLQHVLESWYQLGPPGTTEPEQMGELCFSLRYVPSSGSLTVVVLEARGLNPGLAEAYVKIQLMLNQRKWKKSKTSSKKGTTTPYFNEAFVFLVPVSQLQSVDLVLAVWARGLQLRTEPVGKVLLGSRASGQPLQHWADMLAHARRPIAQWHHLRSPREVDRVLALQPRLPLLRPRS 10E833FA8C454A3B syt9_mouse Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V protein protein mouse Mus musculus Mouse MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQENCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLMEKR E08ECFD9F4D6EE14 syt11_mouse Synaptotagmin-11 Synaptotagmin XI Syt11 protein protein mouse Mus musculus Mouse MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRGPSPASCMDQLPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPIAKWHSLSEY 4E989259BE4FB423 syt5_mouse Synaptotagmin-5 Synaptotagmin V Synaptotagmin IX Syt5 Syt9 protein protein mouse Mus musculus Mouse MFPEPPTLGSPAPKTPPDSSRIRQGAVPAWVLATIVLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDRSPSMPGQQVSDKHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP F884902E032082F6 syt7_mouse Synaptotagmin-7 Synaptotagmin VII Syt7 protein protein mouse Mus musculus Mouse MYRDPEAASPGAPTRDVLLVSAIITVSLSVTIVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRGEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTETRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA 4E63C5779C2ED43E syt3_mouse Synaptotagmin-3 Syt3 Synaptotagmin III protein protein mouse Mus musculus Mouse MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE 87EAEAADF22D5A4C syt4_mouse Synaptotagmin-4 Syt4 Syt3 Synaptotagmin IV protein protein mouse Mus musculus Mouse MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGNFPKANPKAGSSSDLENVTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHFTVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG 9A01144898CDFCEB syt1-syt1-5 1 5 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt2-syt2 1 3 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt3-syt3 1 12 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt4-syt4 1 13 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt5-syt5 1 10 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 2 syt6-syt6 1 6 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt7-syt7 1 11 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt8-syt8 1 7 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt9-syt9 1 8 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt10-syt10 1 4 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 2 syt11-syt11 1 9 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2 syt3-1 1 12 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O35681:p.[Cys10Ala;Cys21Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 14:43:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala,cys21ala' Tue Jun 30 17:35:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys10Ala;Cys21Ala]' O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:17:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala' Tue Jun 30 16:33:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys10Ala' O35681:p.[Cys10Ala;Cys21Ala;Cys33Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 11:00:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys21ala,cys10ala,cys33ala' Wed May 02 19:02:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala,cys21ala,cys33ala' Tue Jun 30 17:21:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys10Ala;Cys21Ala;Cys33Ala]' physical association physical association Fig. 4A The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt3-syt3-1 1 12 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:34:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala' Tue Jun 30 19:51:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys10Ala' 12 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt9-syt3 1 8 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:38:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala' Tue Jun 30 16:53:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys10Ala' physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt6-syt3 1 12 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:57:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala' Tue Jun 30 16:27:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys10Ala' 6 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt3-syt10 1 12 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:27:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys13ala' Tue Jun 30 18:16:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys13Ala' physical association physical association Fig. 5 syt9-syt9-1 1 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:01:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys9ala' Tue Jun 30 18:59:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys9Ala' 8 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt6-syt9 1 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:53:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys9ala' Tue Jun 30 18:11:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys9Ala' 6 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt6-syt6-2 1 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:00:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ala' Tue Jun 30 17:10:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys12Ala' 6 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt10-syt6 1 4 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:55:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ala' Tue Jun 30 19:33:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys12Ala' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt9-syt10 1 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:44:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys13ala' Tue Jun 30 17:21:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys13Ala' 8 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt6-syt10 1 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:57:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys13ala' Tue Jun 30 15:39:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys13Ala' 6 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt10-syt10-2 1 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:50:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys13ala' Tue Jun 30 16:37:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys13Ala' 4 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt3-syt9 1 12 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:50:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys9ala' Tue Jun 30 19:10:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys9Ala' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt9-syt6 1 8 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:35:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ala' Tue Jun 30 17:30:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys12Ala' physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt10-syt9 1 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:36:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys9ala' Tue Jun 30 18:19:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys9Ala' 4 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt10-syt3 1 4 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:33:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys10ala' Tue Jun 30 20:00:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys10Ala' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt3-syt6 1 6 unspecified role unspecified role prey prey Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:28:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ala' Tue Jun 30 16:32:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys12Ala' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5 syt3-syt3-2 2 12 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6 Homodimerisation is beta-mercaptoethanol-sensitive