IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Mol. Cell. Biol. (0270-7306) 1999 Lee SJ., Baserga SJ. susan.baserga@yale.edu 06-April-2011: Contacted by JYOTI. Yeast cDNA jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip northern blot northern blot northen Lee SJ., Baserga SJ. susan.baserga@yale.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 jyoti Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Mol. Cell. Biol. (0270-7306) 1999 Lee SJ., Baserga SJ. susan.baserga@yale.edu 06-April-2011: Contacted by JYOTI. Yeast cDNA jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee SJ., Baserga SJ. susan.baserga@yale.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 jyoti Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Mol. Cell. Biol. (0270-7306) 1999 Lee SJ., Baserga SJ. susan.baserga@yale.edu 06-April-2011: Contacted by JYOTI. Yeast cDNA jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee SJ., Baserga SJ. susan.baserga@yale.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 jyoti Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Mol. Cell. Biol. (0270-7306) 1999 Lee SJ., Baserga SJ. susan.baserga@yale.edu 06-April-2011: Contacted by JYOTI. Yeast cDNA jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip northern blot northern blot northen Lee SJ., Baserga SJ. susan.baserga@yale.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 jyoti Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. Mol. Cell. Biol. (0270-7306) 1999 Lee SJ., Baserga SJ. susan.baserga@yale.edu 06-April-2011: Contacted by JYOTI. Yeast cDNA jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee SJ., Baserga SJ. susan.baserga@yale.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 jyoti mpp10_yeast U3 small nucleolar RNA-associated protein MPP10 MPP10 YJR002W J1411 YJR83.5 M phase phosphoprotein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL DEAF52FC003A0FFD DEAF52FC003A0FFD imp3_yeast U3 small nucleolar ribonucleoprotein protein IMP3 IMP3 Interacting with MPP10 protein 3 YHR148W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS 2CA16A3425691DBD 2CA16A3425691DBD imp4_yeast U3 small nucleolar ribonucleoprotein protein IMP4 IMP4 YNL075W N2353 Interacting with MPP10 protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEADDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTANKKDYL DF9F863364848B63 u3_yeast_snrna Yeast (S.cerevisiae) U3 small nuclear RNA. snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GTCGACGTACTTCATAGGATCATTTCTATAGGAATCGTCACTCTTTGACTCTTCAAAAGAGCCACTGAATCCAACTTGGTTGATGAGTCCATAACCTTTGTACCCCAGAGTGAGAAACCGAAATTGAATCTAAATTAGCTTGGTCCGCAATCCTTAGCGGTTCGGCCATCTATAATTTTGAATAAAAATTTTGCTTTGGCGTTGCATTTGTAGTTTTTTCCTTTGGAAGTAATTACAATATTTTATGGCGCGATGATCTTGACCCATCCTATGTACTTCTTTTTTGAAGGGATAGGGCTCTATGGGTGGGTACAAATGGCAGTCTGACAAGT FC088CA78CC3D20D mpp10-imp3-1 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association mpp10-imp4-1 3 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association mpp10-imp3-2 5 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2 mpp10-imp4-2 5 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2 mpp10-imp3-3 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7B mpp10-imp4-3 2 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association Fig. 7B imp3-u3-1 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 8A imp4-u3-1 1 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association Fig. 7B mpp10-u3-1 4 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 8A