IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Cell (0092-8674) 1997 imex curation Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip partial id prot seq partial identification of protein sequence partial id prot seq Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu Accepted 2010-APR-16 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 1997 jyoti Only protein-protein interactions imex curation The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Cell (0092-8674) 1997 imex curation Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro cleavage cleavage assay cleavage weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu Accepted 2010-APR-16 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 1997 jyoti Only protein-protein interactions imex curation The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Cell (0092-8674) 1997 imex curation Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu Accepted 2010-APR-16 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 1997 jyoti Only protein-protein interactions imex curation The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Cell (0092-8674) 1997 imex curation Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Trotta CR., Miao F., Arn EA., Stevens SW., Ho CK., Rauhut R., Abelson JN. Three separate procedures were utilized for sequencing the subunits of endonuclease. For the 34 kDa subunit, protein was digested in-gel with lysyl-endoprotease, peptides were sequenced by Edman degradation. For the 54 kDa subunit protein was digested in-gel with trypsin and peptides identifed by mass spectrometry on a Voyager Mass Spec and Edman Degradation sequencing. For the 15 kDa subunit, protein was subject to in-gel trypsin digestion, followed by peptide sequencing by LC/MS-MS. abelsonj@starbase1.caltech.edu Accepted 2010-APR-16 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 1997 jyoti Only protein-protein interactions imex curation trna phe gaa precursor trna Phe GAA precursor trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGGACUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAAAAACUUCGGUCAAGUCAUCUGGAGGUCCUGUGUUCGAUCCACAGAGUUCGCA sen2_yeast tRNA-splicing endonuclease subunit SEN2 SEN2 YLR105C L8004.12 tRNA-intron endonuclease SEN2 Splicing endonuclease protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALNDKVHVDFIGDTTLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEARLGLNDTPLHNRGGTKSNTETEMTLEKVTQQRRLQRLEFKKERAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQTEDVGIVAQQQDISESNLRDEDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPACLAGKLFQFDAKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEFCVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKSNNFTKLFNSFQVGEVLYKRWVPGRNRD B5A9C7F865538F5C B5A9C7F865538F5C sen15_yeast tRNA-splicing endonuclease subunit SEN15 SEN15 YMR059W YM9796.12 tRNA-intron endonuclease SEN15 Splicing endonuclease of 15 kDa protein protein yeast Saccharomyces cerevisiae Baker's yeast MATTDIISLVKNNLLYFQMWTEVEILQDDLSWKGNSLRLLRGRPPHKLSNDVDTEHENSLSSPRPLEFILPINMSQYKENFLTLECLSQTFTHLCSPSTERILLAIINDDGTIVYYFVYKGVRKPKRN 17DF8B5F3824DF82 17DF8B5F3824DF82 sen34_yeast tRNA-splicing endonuclease subunit SEN34 SEN34 YAR008W FUN4 tRNA-intron endonuclease SEN34 Splicing endonuclease of 34 kDa protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPLVFDIDHIKLLRKWGICGVLSGTLPTAAQQNVFLSVPLRLMLEDVLWLHLNNLADVKLIRQEGDEIMEGITLERGAKLSKIVNDRLNKSFEYQRKFKKDEHIAKLKKIGRINDKTTAEELQRLDKSSNNDQLIESSLFIDIANTSMILRDIRSDSDSLSRDDISDLLFKQYRQAGKMQTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDPLRFHSHLTIQDAIDYHNEPIDLISMISGARLGTTVKKLWVIGGVAEETKETHFFSIEWAGFG CCEA2A30209AB03F CCEA2A30209AB03F sen54_yeast tRNA-splicing endonuclease subunit SEN54 SEN54 YPL083C LPF3C tRNA-intron endonuclease SEN54 Splicing endonuclease of 54 kDa protein protein yeast Saccharomyces cerevisiae Baker's yeast MQFAGKKTDQVTTSNPGFEEEEEEEEELQQDWSQLASLVSKNAALSLPKRGEKDYEPDGTNLQDLLLYNASKAMFDTISDSIRGTTVKSEVRGYYVPHKHQAVLLKPKGSFMQTMGRADSTGELWLDFHEFVYLAERGTILPYYRLEAGSNKSSKHETEILLSMEDLYSLFSSQQEMDQYFVFAHLKRLGFILKPSNQEAAVKTSFFPLKKQRSNLQAITWRLLSLFKIQELSLFSGFFYSKWNFFFRKYTTSPQLYQGLNRLVRSVAVPKNKKELLDAQSDREFQKVKDIPLTFKVWKPHSNFKKRDPGLPDFQVFVYNKNDDLQHFPTYKELRSMFSSLDYKFEFLSEIEDDDDWETNSYVEDIPRKEYIHKRSAKSQTEKSESSMKASFQKKTAQSSTKKKRKAYPPHIQQNRRLKTGYRSFIIAIMDNGLISFVKMSEADFGSESVWYTPNTQKKVDQRWKKH 363A703856DE724E sen2-sen15-1 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A sen2-sen15-2 3 6 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey physical association physical association Fig. 2C sen15-sen34-1 4 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 3 Two interactions were detected in vivo: interaction between Sen2p and Sen54p, and between Sen34p and Sen15p sen15-sen34-2 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 3 Two interactions were detected in vivo: interaction between Sen2p and Sen54p, and between Sen34p and Sen15p sen2-sen54-1 4 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 3 Two interactions were detected in vivo: interaction between Sen2p and Sen54p, and between Sen34p and Sen15p sen34p trna phe-1 2 5 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 enzyme enzyme neutral component neutral component tag His-flag tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeast Saccharomyces cerevisiae Baker's yeast cleavage cleavage reaction cleavage Fig 6