MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists. Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists. FEBS J. (1742-464X) 2011 Worrall JA., Mason JM. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc peptide synthesis peptide synthesis Worrall JA., Mason JM. FEBS J. (1742-464X) 2011 Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists. Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists. FEBS J. (1742-464X) 2011 Worrall JA., Mason JM. in vitro In vitro cd circular dichroism CD CD cd peptide synthesis peptide synthesis Worrall JA., Mason JM. FEBS J. (1742-464X) 2011 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 fos-jun-1 1 c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 f2a f3 fos-jun-1 1 FosW 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 f3 FosW sequence: LDELQAE IEQLEER NYALRKE IEDLQKQ LEKL FosW has been designed to target the cJun peptide and forms a dimeric complexe with cJun that is much more stable than wild-type. fos-jun-1 1 c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FosW core 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint FosW core sequence: IDELQAE VEQLEER NYALRKE VEDLQKQ AEKL FosW core has been designed to target the cJun peptide and forms a dimeric complexe with cJun that is much more stable than wild-type. t2 f2c f3 fos-jun-1 1 c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain JunW 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint t2 f3 JunW sequence: AAELEER VKTLKAE IYELQSE ANMLREQ IAQL Analysis of the ITC data informs that, in agreement with thermal denaturation data, there is almost no change in the free energy of binding. fos-jun-1 1 c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain JunW candi 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint JunW candi sequence: AAELEER AKTLKAE IYELRSK ANMLREH IAQL Analysis of the ITC data informs that, in agreement with thermal denaturation data, there is almost no change in the free energy of binding. However, dissection of this value into its thermodynamic components reveals JunWCANDI to have a slight increase in enthalpy change upon binding cFos (-14.8 vs. -13.9 kcal·mol-1), suggesting that more non-covalent bonds have been formed. t2 f2b f3 fos-jun-1 1 c-Jun (R) 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FosW (E) 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint t2 f3 cJun(R)- IARLRER VKTLRAR NYELRSR ANMLRER VAQL FosW(E)- LDELEAE IEQLEEE NYALEKE IEDLEKE LEKL This designed interaction was generated to investigate the role of electrostatics in the folding of Jun-Fos based AP-1 coiled coils. The ITC data show that for this dimer there is a very large enthalpic contribution to the interaction stability (-27 kcal·mol-1) relative to the other PCA selected antagonists (-10.6 to -14.8 kcal·mol-1), that is in turn compensated for by an opposing but comparatively small entropic penalty (-17.4 kcal·K-1·mol-1). fos-jun-1 2 c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t3 f3 fos-jun-1 2 c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FosW 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint FosW sequence: LDELQAE IEQLEER NYALRKE IEDLQKQ LEKL . t3 f3 fos-jun-1 2 c-Jun 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FosW core 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint FosW core sequence: IDELQAE VEQLEER NYALRKE VEDLQKQ AEKL t3 f3 fos-jun-1 2 c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain JunW 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint JunW sequence: AAELEER VKTLKAE IYELQSE ANMLREQ IAQL t3 f3 fos-jun-1 2 JunW candi 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm c-Fos 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint JunW candi sequence: AAELEER AKTLKAE IYELRSK ANMLREH IAQL t3 f3 fos-jun-1 2 c-Jun (R) 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FosW (E) 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain other modification other modification uncategorized protein modification uncategorized protein modification mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint cJun(R)- IARLRER VKTLRAR NYELRSR ANMLRER VAQL FosW(E)- LDELEAE IEQLEEE NYALEKE IEDLEKE LEKL t3 f3