MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. FEBS Lett. (0014-5793) 2010 imex curation DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. FEBS Lett. (0014-5793) 2010 imex curation DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. FEBS Lett. (0014-5793) 2010 imex curation DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. Characterization of GmCaMK1, a member of a soybean calmodulin-binding receptor-like kinase family. FEBS Lett. (0014-5793) 2010 imex curation DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant DeFalco TA., Chiasson D., Munro K., Kaiser BN., Snedden WA. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation c6zry5_soybn 100817345 GLYMA_12G216000 protein protein soybn Glycine max (Soybean) Glycine hispida MKEESTGLIIGISIGVVIGVGLAISALFCLRYHRKRSQIGNSSSRRAHTIPIRENGVDSCNILSDSTLGPESPVRSGRNGMSLWLDGFKKSSNMVSASGIPEYSYKDLQKATYNFTTLIGQGAFGPVYKAQMSTGETVAVKVLATNSKQGEKEFQTEVMLLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSKGSLASHLYSEENGALGWDLRVHIALDVARGIEYLHDGAVPPVIHRDIKSSNILLDQSMRARVADFGLSREEMVDKHAAIRGTFGYLDPEYISSGTFTKKSDVYSFGVLLFELIAGRNPQQGLMEYVELAAMNTEGKVGWEEIVDSRLEGKCDFQELNQVAALAYKCINRAPKKRPSMRDIVQVFTRILKSRYQRNHHHKKSLSATVDEVSIDVDQLETKSSVTDHRREESIDSTADIYDL mint A6C91C378675963C c6tiq0_soybn Protein kinase domain-containing protein protein protein soybn Glycine max (Soybean) Glycine hispida MKEESVGLIIGVSIGVVIGLVLAIFAFFCHRYHRKRSQIGNSSSRRAATIPIRTNGADSCTILSDSTLGPESPIKSDRHGMPFWLDGFKKSSSMIPASGLPEYAYKDLQKATHNFTTVIGEGAFGPVYKAQMSTGETVAVKVLATNSKQGEKEFNTEVMLLGRLHHRNLVNLVGYCAEKGKHMLVYVYMSNGSLASHLYSDVNEALSWDLRVPIALDVARGLEYLHNGAVPPVIHRDIKSSNILLDQSMRARVADFGLSREEMVDKHAAIRGTFGYLDPEYISSGTFTKKSDVYSFGVLLFEIIAGRNPQQGLMEYVELAAMNTEGKVGWEEIVDSRLQGNFDVKELNEMAALAYKCINRAPSKRPSMRDIVQVLTRILKSRNHGSHHKNSLSATDEVFIDTDQLENKISVTDHRREESLDSVAEVYEV mint 5818686701BA8784 crlk2_arath Calcium/calmodulin-regulated receptor-like kinase 2 F14F8.110 At5g15730 CRLK2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVNRSDLVVIGISVGLALGLLLALLLFFAIKWYYGRSHLRRCANEQNSPTLPVHTAKRGVVIPDDRANTESSQPPENGAPTQHQPWWNNHTKDLTVSASGIPRYNYKDIQKATQNFTTVLGQGSFGPVYKAVMPNGELAAAKVHGSNSSQGDREFQTEVSLLGRLHHRNLVNLTGYCVDKSHRMLIYEFMSNGSLENLLYGGEGMQVLNWEERLQIALDISHGIEYLHEGAVPPVIHRDLKSANILLDHSMRAKVADFGLSKEMVLDRMTSGLKGTHGYMDPTYISTNKYTMKSDIYSFGVIILELITAIHPQQNLMEYINLASMSPDGIDEILDQKLVGNASIEEVRLLAKIANRCVHKTPRKRPSIGEVTQFILKIKQSRSRGRRQDTMSSSFGVGYEEDLSRVMSRIKDQHVELGLLAGVKEENHQERNIATT mint 54CE48B32B4CCACC c6zrs6_soybn 100786710 GLYMA_06G265600 protein protein soybn Glycine max (Soybean) Glycine hispida MKEESVGLIIGVSIGVVIGLVLAIFAFFCHRYHRKRSQIGNSSSRRAATIPIRTNGADSCTILSDSTLGPESPIKSDRHGMPFWLDGFKKSSSSMIPASGLPEYAYKDLQKATHNFTTVIGEGAFGPVYKAQMSTGETVAVKVLATNSKQGEKEFNTEVMLLGRLHHRNLVNLVGYCAEKGKHMLVYVYMSNGSLASHLYSDVNEALSWDLRVPIALDVARGLEYLHNGAVPPVIHRDIKSSNILLDQSMRARVADFGLSREEMVDKHAAIRGTFGYLDPEYISSGTFTKKSDVYSFGVLLFEIIAGRNPQQGLMEYVELAAMNTEGKVGWEEIVDSRLQGNFDVKELNEMAALAYKCINRAPSKRPSMRDIVQVLTRILKSRNHGSHHKNSLSATDEVFIDTDQLENKISVTDHRREESLDSVAEVYEV mint 145FDB60899A0CC1 calm1_pethy Calmodulin-1 CAM81 protein protein pethy Petunia hybrida (Petunia) MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK mint EB2B188A90AD508D c6zry5-cam81 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified C6ZRY5:p.Val372Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Tue Jul 12 10:18:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:16:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val372glu' Tue Jun 30 16:18:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val372Glu' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint Recombinant GmCaMK1 bound CaM in a Ca2+-dependent manner (Fig. 1C). f1b f1c f7 c6zry5-cam81-1 1 GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain C6ZRY5:p.Val372Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Tue Jul 12 10:19:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:30:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val372glu' Tue Jun 30 16:06:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val372Glu' CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f3c domino mint c6zry5-cam81-2 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:56:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Leu375Glu binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3c domino mint c6zry5-cam81-3 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain C6ZRY5:p.Arg377Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:56:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:36:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg377ala' Tue Jun 30 18:53:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377Ala' direct interaction direct interaction f3c domino mint c6zry5-cam81-4 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain C6ZRY5:p.Lys380Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:56:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:59:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys380ala' Tue Jun 30 16:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys380Ala' direct interaction direct interaction f3c domino mint c6zry5-cam81-5 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK2 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7 mint c6zrs6-cam81 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK3 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7 mint c6tiq0-cam81 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified GmCaMK4 6 edman degradation edman degradation predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7 mint y5157-cam81 1 CaM 9 elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified AtCRLK2 7 edman degradation edman degradation predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7 mint c6zry5-cam81-6 2 CaM 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.1 direct interaction direct interaction f2 t1 domino mint c6zry5-cam81-7 3 GmCaMK1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.1 CaM 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 direct interaction direct interaction f3b domino mint ND-PAGE showed that CaM forms a 1:1 molar ratio complex with the CaMBD peptide, and does so only in the presence of Ca2+ (Fig. 3B). c6zry5-cam81-8 4 CaM 9 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 GmCaMK1 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.1 direct interaction direct interaction f4 domino mint