MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. FEBS J. (1742-464X) 2010 imex curation Loeber J., Claussen M., Jahn O., Pieler T. Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. FEBS J. (1742-464X) 2010 imex curation Loeber J., Claussen M., Jahn O., Pieler T. Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. FEBS J. (1742-464X) 2010 imex curation Loeber J., Claussen M., Jahn O., Pieler T. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation elv1a_xenla ELAV-like protein 1-A elavl1-a elavl1 elrA Protein ElrA-A 36 kDa embryonic-type cytoplasmic polyadenylation element-binding protein protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSNGYEDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGFEMRSSSLSKGHSLGYGFVNYLNAKDAERAINTLNGLRLQSKTIKVSFARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFGHIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNVALLSQICHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISSVNVASSATSGWCIFVYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVSFKTSKSHK mint BEE8BF72CF1F03BE ef1a1_xenla Elongation factor 1-alpha 42Sp50 Thesaurin A protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTDKAPQKTHLNIVIIGHVDSGKSTTTGHLIYKCGGFDPRALEKVEAAAAQLGKSSFKFAWILDKLKAERERGITIDISLWKFQTNRFTITIIDAPGHRDFIKNMITGTSQADVALLVVSAATGEFEAGVSRNGQTREHALLAYTMGVKQLIVCVNKMDLTDPPYSHKRFDEVVRNVMVYLKKIGYNPATIPFVPVSGWTGENISSPSQKMGWFKGWKVKRKDGFTKGQSLLEVLDALVPPVRPANKPLRLPLQDVYKIGGIGTVPVGKIETGILKPGMTISFAPSGFSAEVKSIEMHHEPLQMAFPGFNIGFNVKNIAVKSLKRGNVAGNSKSDPPTEASSFTAQVIILNHPGFIKAGYSPVIDCHTAHITCQFAELQEKIDRRTGKKLEDNPGLLKSGDAAIITLKPIKPFCVERFFDYPPLGRFAARDLKQTVAVGVVKSVEHKAGAAARRQVQKPVLVK mint 96F482F4B198C128 q5mnu4_xenla stau1.L Stau1 stau1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDVTMSQAPKSPAAPLPKIQILNKNQHSPLPQPLSIPSTASPLPSENAGRPLQNSALPSPSVTSSGPTAVSSNMANPKEKTPMCLVNELARFNKIQPVYKLLSEQGPAHSKVIPLGRWQDYSLLERVGEERPRQMFTVQLTLGDQYWEAEGTSIKKAQHAAAAKALEGTKYPKPTVRPVRGERKYPDSITPTVELNALCMKLGRKPIYKPLDPYTGIRSAYNYNMRGGGYPPRYFYPFPVAPILYQVELSVGGQQFHGKGRTRQAAKHDAAARALKSLHHEPLPDKPALNGKAADEENLNKSEISQVFEIALKRNMSVNFEVTKETGPPHMKSFLTKVIVGEFLGEGEGKSKKISKKNAAIAVLEELRKLPPLPTVEKMRPKIKKKTKSIVKLPTSPEYGQGMNPISRLAQIQQAKKGKEPEYILITERGLPRRREFVMQVKVGNHAAEGSGTNKKVAKRNAAENMLEILGFKVPPPPPKPALKTEEKLPVKKPGDGRKVTFYEPGSGEDGANHNKDDEFRMPYHSHQQLPAGILPMVPEVAQAVGVNQGLHTKEFNRVAPNPAKATVTAMIARELLYAGISPTADTILKNNNAAGHVLRGPFTRPSEQLNYLSRVQGLEVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQNPEMPRTGNGPMSVCVKPEMESDPLLKPANSNTLGQTLDSTA mint 9F221278CC69CF56 q9pts5_xenla ptbp1.L VgRBP60 ptbp1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGIVQDITVGTKRGSDELFSCVTNGPFIMSNAAAGENLYGSNGNDSKKFKGDGRSVAVGSRVIHLRKLPGDVTEAEVISLGLPFGKVTNILMLKGKNQAFLEMSTEEAANTMISYYTNVAPVLRSQPIYIQYSNHKELKTDDSPNQARAQAALQAVNSVVSGTTALSASAAAVDVGIAMSGQSPVLRIIVENLFYPVTLDVLQQIFSKFGTVLKIITFTKNNQFQALLQYGDPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDGQPSLDQTIAAFGAPGLISANPYAGAGFHPAFAIPQGVHGLAPLTLPSAAAAAAAAAGRLGIHGLGIPGNSVLLVSNLNPERVTPQCLFILFGVYGDVHRVKILFNKKENALVQMADGNQAQLAMSHLNGQRLHGKPLRTTVSKHQTVQLPREGQEDQGLTKDYSTSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKILFSNNGYAVKGFKFFQKDRKMALIQMGSVEEAIESLIELHNHDMGENHHHRVSFSKSTI mint 0DA2AC285E7F8D6C q6gm69_xenla hnrnpab.S XELAEV_18021534mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSDSEQQYMETNAENGHEACDAEAAEGKGAGGGQNDAEGDQINASKGEEEAGCVAEISSPLTEGVKMFVGGLSWDTSKKDLKDYFEKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEHKEHRLDGRLIDPKKAMAMKKEPIKKIFVGGLNPEAGEDKIREYFETFGEIEAVELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKEVYQQQYGGRGGSFGGRGGRGGKGQGQNWNQGYNNYWNQGYGNQGYGSYGQQGYGGYGNYDYSGYGYYGYGPGYDYSQGGANYGKAPRRGGHQSNYKPY mint F6517A4610F31F2C elav2_xenla ELAV-like protein 2 elavl2 el-1 elavl2-a elrB Protein ElrB Elav like-1 p45 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANCPNTINCSSPVESNNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITEGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVNHTILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGGIKSRFSPMAIDGMTSLAGINFPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSKTHKA mint 200C18CA6EE0D1BC if23a_xenla Insulin-like growth factor 2 mRNA-binding protein 3-A KH domain-containing transcription factor B3-A Vg1 localization element binding protein A Vg1 RNA-binding protein A RNA-binding protein Vera-A VLE-binding protein A VgLE-binding and ER association protein A 69 kDa RNA-binding protein A Trans-acting factor B3-A VICKZ family member 3-A IGF-II mRNA-binding protein 3-A igf2bp3-a vera-a vickz3-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNKLYIGNLSENVSPTDLESLFKESKIPFTGQFLVKSGYAFVDCPDETWAMKAIDTLSGKVELHGKVIEVEHSVPKRQRSRKLQIRNIPPHLQWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYANKEHARQGLEKLNGYQLENYSLKVTYIPDEMATPQAPSQQLQQQPQQQHPQGRRGFGQRGPARQGSPGAAARPKPQTEVPLRMLVPTQFVGAIIGKEGATIRNITKQTQSKIDIHRKENAGAAEKPITIHSTPEGCSAACKIIMEIMQKEAQDTKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQDLTLYNPERTITVKGSIEPCAKAEEEIMKKIRESYENDIAAMNLQAHLIPGLNLNALGLFPSSSSGMPPPSVGVPSPTSSTSYPPFGQQPESETVHLFIPALAVGAIIGKQGQHIKQLSRFAGASIKIAPAEGPDAKLRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIKVPSYAAGRVIGKGGKTVNELQNLTSAEVVVPRDQTPDENDEVVVKITGHFYASQLAQRKIQEILAQVRRQQQQQQKTVQSGQPQPRRK 54CEA7BFF0856DD6 epaba_xenla Embryonic polyadenylate-binding protein A epabp-a XePABP-A epab protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNATGAGYPLASLYIGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLSYAYINFQQPADAERALDTMNFEVIKGRPIRIMWSQRDPGLRKSGVGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETHEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVMEFTNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDDSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIERQSELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLATMRAMPGPLLGSFQQPANYFLSAMPQPPNRTFYSPNPVAPVRPAPQWASHQSRPPQYQPPTPLMRAVQPRRMSSNISTMKQASTQVPRVAQHSQRVANIGTQTAGARAQVNPSMMRTMPHYKYSCGVRNVQPIVSSTHLQQVMEPAVLMQGQEPLTASLLAGAPPQEQKQMLGERIYPVIHEMHPTLAGKITGMLLEIDNSELLHMLESPESLHSKVEEAVAVLQAHQAKENAQKSAQPSLI mint F9C1BBB5A3E1B3AF ybx2b_xenla Y-box-binding protein 2-B ybx2-b frgy2-b Cytoplasmic RNA-binding protein p54 Frog Y-box protein 2-B Messenger ribonucleoprotein particle 3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSEAEPRETEAVTQPEPAPEIHKPDIVPPRNQINKKLLATQVQGTVKWFNVRNGYGFINRNDSKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRQFYRPRADTAGESGGEGVSPEQMSEGEKGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNNQQNQGAEVTDQSENKDPAAPTSEALASGDGQQRPPPRRFQQRFRRPFRPRPPPPQTPEGGDGEAKAEGEPQRQRNRPYVQRRRRQQPPTVQGESKAEPSEHPASEEGTPSDAPTDDGAPVETSEAGVEDTTAPE mint 8E86D15AE42B49F4 igf2bp3_a-ef1a1 1 Vg1RBP 10 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Vg1RBP 10 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 42Sp50 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level epab 11 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level frgy2-b 12 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1a mint igf2bp3_a-elavl1_a 1 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ElrA 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 40LoVe 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level staufen 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level hnRNPI 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level elrB 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1b mint epabp_a-igf2bp3_a 2 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level epab 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint ybx2_b-igf2bp3_a 2 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level frgy2-b 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint ef1a1-igf2bp3_a 2 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 42Sp50 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint ef1a1-igf2bp3_a-1 2 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level staufen 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 42Sp50 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3 mint 42Sp50 interacts with both Vg1RBP and Staufen1 in the presence of intact RNA but not if cellular RNA is destroyed by RNAse digestion ef1a1-igf2bp3_a-2 3 Vg1RBP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level staufen 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 42Sp50 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 40LoVe 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f4 mint