IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch Accepted 2010-DEC-09 by MGT 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared Additional information on constructs obtained from the author gad.asher@unige.ch Accepted 2010-DEC-09 by MGT 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift antibody detection identification by antibody antibody detection Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch Accepted 2010-DEC-09 by MGT 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Poly(ADP-ribose) polymerase 1 participates in the phase entrainment of circadian clocks to feeding. Cell (0092-8674) 2010 imex curation Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Asher G., Reinke H., Altmeyer M., Gutierrez-Arcelus M., Hottiger MO., Schibler U. Mice were sacrificed at 4 hr intervals around the clock, and liver nuclear extracts were prepared gad.asher@unige.ch 06-April-2011: Contacted by JYOTI. Zeitgeber time (ZT) Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT DIP protein O54943 original sequence version: 120 DIP protein O54943 original sequence version: 83 DIP protein O54943 original sequence version: 87 DIP protein O54943 original sequence version: 104 DIP protein O54943 original sequence version: 111 DIP protein O54943 original sequence version: 114 DIP protein O54943 original sequence version: 98 554B8AFF036CF7FB bmal1_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Brain and muscle ARNT-like 1 Arnt3 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8 original sequence version: 134 DIP protein Q9WTL8 original sequence version: 123 DIP protein Q9WTL8 original sequence version: 94 DIP protein Q9WTL8 original sequence version: 128 DIP protein Q9WTL8 original sequence version: 144 DIP protein Q9WTL8 original sequence version: 145 9669C3712A95C2DE parp1_mouse Poly [ADP-ribose] polymerase 1 Poly[ADP-ribose] synthase 1 NAD(+) ADP-ribosyltransferase 1 Parp1 Adprp Adprt Adprt1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein mouse Mus musculus Mouse MAEASERLYRVQYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGQSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFAAEYAKSNRSMCKGCLEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLSAEDKEALKKQLPAIKNEGKRKGDEVDGTDEVAKKKSRKETDKYSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPKEFREISYLKKLKVKKQDRIFPPESSAPITVHWPLSVTSAPTAVNSSAPADKPLSNMKILTLGKLSQNKDEAKAVIEKLGGKLTGSANKASLCISIKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQDLLSAHSLSPWGAEVKAEPGEVVAPRGKSAAPSKKSKGCFKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRLGTVIGSNKLEQMPSKEEAVEQFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVKPGTKSKLPKPVQELVGMIFDVDSMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQPVSQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITLEGVEVPLGTGIPSGVNDTALLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P11103 original sequence version: 122 DIP protein P11103 original sequence version: 163 DIP protein P11103 original sequence version: 164 5E54C3E5F60BB922 clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ DIP protein O08785 original sequence version: 149 DIP protein O08785-1 original sequence version: 138 DIP protein O08785 original sequence version: 138 DIP protein O08785 original sequence version: 108 DIP protein O08785 original sequence version: 143 DIP protein O08785 original sequence version: 155 DIP protein O08785 original sequence version: 159 DIP protein O08785 original sequence version: 160 9864D947049742F4 cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN DIP protein P97784 original sequence version: 119 DIP protein P97784 original sequence version: 108 DIP protein P97784 original sequence version: 86 DIP protein P97784 original sequence version: 110 DIP protein P97784 original sequence version: 113 DIP protein P97784 original sequence version: 125 DIP protein P97784 original sequence version: 130 DIP protein P97784 original sequence version: 95 2F2B8DD53F0A9AF9 adp-ribose ADP-D-ribose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) g-box_probe G box probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CCGCGTCGCCCTGCGCTGTCACATAGTGGAAAACGTGACCGCGCGCGCTGAGCCCGCCCCTGCG 10AD93FF2E7422EA cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS DIP protein Q9R194 original sequence version: 77 DIP protein Q9R194 original sequence version: 94 DIP protein Q9R194 original sequence version: 105 DIP protein Q9R194 original sequence version: 121 DIP protein Q9R194 original sequence version: 87 4D6E7B199C392CBB parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B bmal1-clock-1 1 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 0 Figs. 3B, 3E, 4B In both wild-type and PARP-1-/- mice, immunoprecipitation of BMAL1 resulted in coimmunoprecipitation of CLOCK, indicating that the interaction between BMAL1 and CLOCK is not dependent on PARP-1 bmal1-clock-2 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 4 Figs. 3B, 4B bmal1-clock-3 1 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 8 Figs. 3B, 4B bmal1-clock-4 1 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 12 Figs. 3B,4B bmal1-clock-5 1 14 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 16 Figs. 3B, 4B bmal1-clock-6 1 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 20 Figs. 3B, 4B parp1-bmal1-1 3 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 0 Fig. 3C parp1-bmal1-2 3 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 4 Fig. 3C parp1-bmal1-3 3 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 12 Fig. 3C parp1-bmal1-4 3 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 16 Fig. 3C parp1-bmal1-5 3 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 20 Fig. 3C clock-bmal1-1 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 4 Fig. 3D clock-bmal1-2 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 16 Fig. 3D parp1-clock-1 2 15 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 10 unspecified role unspecified role prey prey direct interaction direct interaction Fig. 3F Finally, the direct interaction of PARP-1 with CLOCK could also be reconstituted in vitro in a pull-down assay with purified recombinant proteins (Figure 3F). adp-ribose-clock 6 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 4 Interaction between ADP-ribose and Clock observed in parp1 -/- cells. Clock remained associated with ADP-ribose even under harsh denaturing conditions (1% SDS) which removed PARP1 Immunoprecipitation experiments were performed using a poly(ADP-ribose) antibody and liver nuclear extracts from wild-type and Parp-1 knockout mice sacrificed at ZT4, Figs. 3G, Supp. Fig. 4 adp_ribose-clock 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 0 Figs. 3I adp_ribose-clock-1 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4 Figs. 3I adp_ribose-clock-2 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 8 Figs. 3I adp_ribose-clock-3 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 12 Figs. 3I adp_ribose-clock-4 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 16 Figs. 3I adp_ribose-clock-5 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 20 Figs. 3I parp1-bmal1-6 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 8 Fig. 3C g-box-bmal1 4 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey mouse-liver Mus musculus liver liver physical association physical association G-box probe is radio-labelled. Supp. Fig. 5C