MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. EMBO J. (0261-4189) 2010 imex curation Schofield WB., Lim HC., Jacobs-Wagner C. Only protein-protein interactions strain na1000 / cb15 Caulobacter crescentus anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schofield WB., Lim HC., Jacobs-Wagner C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. EMBO J. (0261-4189) 2010 imex curation Schofield WB., Lim HC., Jacobs-Wagner C. Only protein-protein interactions strain na1000 / cb15 Caulobacter crescentus fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Schofield WB., Lim HC., Jacobs-Wagner C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation parb_cauvn Chromosome-partitioning protein ParB parB CCNA_03868 protein protein strain na1000 / cb15 Caulobacter crescentus MESVVVGEPGMSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSPDTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLSAGKSKGGRPPRVKDTDTQALESDLSSVLGLDVSIDHRGSTGTLTITYATLEQLDDLCNRLTRGI mint 930BD2D2D4B83ECF a0a0h3c899_cauvn tipN CCNA_01552 protein protein strain na1000 / cb15 Caulobacter crescentus MKPKKRQPLDFSATPTEIPPEEPKTAPELPESASFVAPDAEPSFAEPLTLSDAAPDDLAVPTPTSVRSRRRREAETARFAEPDMKVANSLAATPQPPAPILEPSAPSAPPARSETREAALDLRGSVSASAASLEAEVVPRRMSGVLFWTLATAVAALWALAPIAFALGYARGVPAFKIEGFALMVFAGLAIGPALLTLLGAYMLRQANGISDELRRNRTLTDRLVTPAALAAAGATNAVDAMRQGVDEAAAAAERAREHIISLRKALAEETARLAEAAAESARMANQLAQGLSHERSAMETLSQSLDARSTAVVDAIGSQARMVAEASDLAETQLREAEAALAARAADLAAAAAEASDAARVGAEDLSRQIARLETAGVGVGDQVASVEKTLAAQRAALVEISQALRSEQEDFAAEAETRTAQLTEFVAYTRVGATELSDTAAMGAEILRGLISAAADQFREMADGAKSQRDTLAEEAKKTLETIGDVAENQRTLLEEELKAAMEAMAEAALKAGESVEARVEAARSRVDQLNEIAFAAGQKADAVFESRMEEARDIIEHSAQMVEQAGARTSQKLQDSVQTARSTLDELEVMLAEIGRRTADLPAEALQKAGEVRIAIEQGVEHLMNAVRRTAEETAAIDQAFQERVRRNYEMLSEAAGAVTASGISTVAARATPAAPPPSRSRAAPPPSALPTVEFDDEDEPPSDRRRLRLTPTATDQEFRSVFEQASARKQTGTPPTEAEADGNWSWRGLLSGIESSSPGDAGLGEKLAAEITAMGIDPHALLPRGRIDEIAAALQTRDGEGAREVVKRLAPAAIRRLVRRLFSDATLKGNTERFLKRYAGMIDEAAGQDREGFLLAALLSSDAGRAYLLLDAASGDLA 4C68D18A356686CA para_cauvn Chromosome partitioning protein ParA parA CCNA_03869 protein protein strain na1000 / cb15 Caulobacter crescentus MSANPLRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRTTLYDVLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIRANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQAYLKLAREVISRERDRQAKAA mint 6573A4D495A7007C tipn-para 1 parA 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tipN 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint tipn-para-1 1 parA 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell B8GW31:p.Gly16Val mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V Tue Jul 12 10:07:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:12:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly16val' Tue Jun 30 17:03:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly16Val' yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tipN 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4g mint pull-down assays (Figure 4G) are consistent with the G16V mutant having a higher affinity for TipN than the D44A R195E double mutant, supportive of a conformational difference between these mutants. para-tipn 2 parA 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tipN 4 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction f3b mint para-parb-2 2 parA 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined parB 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction sf5a mint