IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress. Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress. Cell (0092-8674) 2010 imex curation Seifert U., Bialy LP., Ebstein F., Bech-Otschir D., Voigt A., Schroter F., Prozorovski T., Lange N., Steffen J., Rieger M., Kuckelkorn U., Aktas O., Kloetzel PM., Kruger E. I have not added data when only purification method is native PAGE. Data in S4 lost as I was unsure both about host cell type and details of purification. Proteasomes were immunoprecipitated from glycerol gradient fractions enriched for 26S complexes p-m.kloetzel@charite.de, elke.krueger@charite.de 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seifert U., Bialy LP., Ebstein F., Bech-Otschir D., Voigt A., Schroter F., Prozorovski T., Lange N., Steffen J., Rieger M., Kuckelkorn U., Aktas O., Kloetzel PM., Kruger E. I have not added data when only purification method is native PAGE. Data in S4 lost as I was unsure both about host cell type and details of purification. Proteasomes were immunoprecipitated from glycerol gradient fractions enriched for 26S complexes p-m.kloetzel@charite.de, elke.krueger@charite.de Accepted 2010-OCT-14 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress. Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress. Cell (0092-8674) 2010 imex curation Seifert U., Bialy LP., Ebstein F., Bech-Otschir D., Voigt A., Schroter F., Prozorovski T., Lange N., Steffen J., Rieger M., Kuckelkorn U., Aktas O., Kloetzel PM., Kruger E. I have not added data when only purification method is native PAGE. Data in S4 lost as I was unsure both about host cell type and details of purification. Proteasomes were immunoprecipitated from glycerol gradient fractions enriched for 26S complexes p-m.kloetzel@charite.de, elke.krueger@charite.de 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seifert U., Bialy LP., Ebstein F., Bech-Otschir D., Voigt A., Schroter F., Prozorovski T., Lange N., Steffen J., Rieger M., Kuckelkorn U., Aktas O., Kloetzel PM., Kruger E. I have not added data when only purification method is native PAGE. Data in S4 lost as I was unsure both about host cell type and details of purification. Proteasomes were immunoprecipitated from glycerol gradient fractions enriched for 26S complexes p-m.kloetzel@charite.de, elke.krueger@charite.de Accepted 2010-OCT-14 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Exposure to 100 U/ml interferon-gamma (hrs) Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation psb9_human Proteasome subunit beta type-9 PSMB9 LMP2 RING12 Proteasome subunit beta-1i Proteasome chain 7 Macropain chain 7 Multicatalytic endopeptidase complex chain 7 Really interesting new gene 12 protein Low molecular mass protein 2 PSMB6i protein protein human Homo sapiens Human MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE 3B321F83641941AC psb10_human Proteasome subunit beta type-10 PSMB10 MECL1 Proteasome subunit beta-2i Proteasome MECl-1 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 LMP10 Low molecular mass protein 10 protein protein human Homo sapiens Human MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE D6728E50513A45B9 psb1_human Proteasome subunit beta type-1 PSMB1 PSC5 Proteasome component C5 Macropain subunit C5 Multicatalytic endopeptidase complex subunit C5 Proteasome gamma chain protein protein human Homo sapiens Human MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD DIP protein P20618 original sequence version: 164 AE8FC42799F39157 psb8_human Proteasome subunit beta type-8 PSMB8 LMP7 RING10 Y2 Proteasome subunit beta-5i Proteasome component C13 Macropain subunit C13 Multicatalytic endopeptidase complex subunit C13 Low molecular mass protein 7 PSMB5i Really interesting new gene 10 protein protein protein human Homo sapiens Human MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ 4F689501677DBD44 psb5_human Proteasome subunit beta type-5 PSMB5 LMPX Proteasome epsilon chain Macropain epsilon chain Multicatalytic endopeptidase complex epsilon chain Proteasome subunit X Proteasome chain 6 Proteasome subunit MB1 MB1 X protein protein human Homo sapiens Human MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP DIP protein P28074 original sequence version: 171 DIP protein P28074 original sequence version: 132 AED4A73DF41AA6EF psb7_human Proteasome subunit beta type-7 PSMB7 Proteasome subunit Z Macropain chain Z Multicatalytic endopeptidase complex chain Z Z protein protein human Homo sapiens Human MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS DIP protein Q99436 original sequence version: 152 A610C949A0ACF1CE psmd1_human 26S proteasome non-ATPase regulatory subunit 1 PSMD1 26S proteasome regulatory subunit RPN2 26S proteasome regulatory subunit S1 26S proteasome subunit p112 protein protein human Homo sapiens Human MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD B8682146082D21FA psa4_human Proteasome subunit alpha type-4 PSMA4 PSC9 Proteasome component C9 Macropain subunit C9 Multicatalytic endopeptidase complex subunit C9 Proteasome subunit L HC9 protein protein human Homo sapiens Human MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK DIP protein P25789 original sequence version: 160 DIP protein P25789 original sequence version: 133 DIP protein P25789 original sequence version: 114 DIP protein P25789 original sequence version: 149 7867422B1B31F3B9 psb2_human Proteasome subunit beta type-2 PSMB2 Multicatalytic endopeptidase complex subunit C7-I Proteasome component C7-I Macropain subunit C7-I protein protein human Homo sapiens Human MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS DIP protein P49721 original sequence version: 156 04D085D7BAA76130 psmb7-psma4-1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Association of 19S subunit Rpn2 to 20S proteasome is transiently decreased between 4 and 8 hrs of IFN-gamma induction, whereas levels of the constitutive subunit alpha-4 remain constant. Fig. 3E Interferon-gamma psmb8-psma4-1 2 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Supp. Fig. 3A 0 The content of the proteasome changes with exposure to Interferon-gamma. psmb8-psma4-2 2 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Supp. Fig. 3A 4 The content of the proteasome changes with exposure to Interferon-gamma. psmb8-psma4-3 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Supp. Fig. 3A 8 The content of the proteasome changes with exposure to Interferon-gamma. psmb8-psma4-4 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Supp. Fig. 3A 12 The content of the proteasome changes with exposure to Interferon-gamma. psmb8-psma4-5 2 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey association association Supp. Fig. 3A 24 The content of the proteasome changes with exposure to Interferon-gamma. At this time point, levels of PSMB5 are declining