MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. EMBO J. (0261-4189) 2010 imex curation Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. EMBO J. (0261-4189) 2010 imex curation Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. EMBO J. (0261-4189) 2010 imex curation Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. Calmodulin dissociation regulates Myo5 recruitment and function at endocytic sites. EMBO J. (0261-4189) 2010 imex curation Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Grötsch H., Giblin JP., Idrissi FZ., Fernández-Golbano IM., Collette JR., Newpher TM., Robles V., Lemmon SK., Geli MI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation calm_yeast Calmodulin YBR0904 YBR109C CMD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK 819ED1AD5D9400D3 819ED1AD5D9400D3 myo5_yeast Myosin-5 MYO5 YMR109W YM9718.08 Class I unconventional myosin MYO5 Type I myosin MYO5 Actin-dependent myosin-I MYO5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAILKRGARKKVHQEPAKRSANIKKATFDSSKKKEVGVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDRESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRRIDAATKIQRTIRERKEGNKYEKLRDYGTKVLGGRKERRSMSLLGYRAFMGDYLSCNESKSKGAYIKRQVSIKEKVIFSIHGEALHTKFGRSAQRLKKTFLLTPTTLYIVGQTLVQNAMTYTQDYKIDVRNIQAVSLTNLQDDWVAIKLASSGQPDPLINTYFKTELITHLKRLNDKIQIKIGSAIEYQKKPGKLHSVKCQINESAPKYGDIYKSSTISVRRGNPPNSQVHKKPRKKSSISSGYHASSSQATRRPVSIAAAQHVPTAPASRHSKKPAPPPPGMQNKAATRRSVPNPASTLTASQSNARPSPPTAATRATPAATPAAAAMGSGRQANIPPPPPPPPPSSKPKEPMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPHSGNNNIPTPPQNRDVPKPVLNSVQHDNTSANVIPAAAQASLGDGLANALAARANKMRLESDDEEANEDEEEDDW DFFB9EC16B61CD29 DFFB9EC16B61CD29 rv167_yeast Reduced viability upon starvation protein 167 D9509.8 YDR388W RVS167 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFKGFTKAVSRAPQSFRQKFKMGEQTEDPVYEDAERRFQELEQETKKLSEESKRYSTAVNGMLTHQIGFAKSMEEIFKPISGKMSDPNATIPEDNPQGIEASEQYRAIVAELQETLKPDLALVEEKIVTPCQELLKIITYIRKMATKRNHKKLDLDRHLNTYNKHEKKKEPTAKDEERLYKAQAQVEVAQQEYDYYNDLLKTQLPILFSLEAEFVKPLFVSFYFMQLNIFYTLYNRLQDMKIPYFDLNSDIVESYIAKKGNVEEQTDALTITHFKLGYSKAKLEMTRRKYGVATAEGSPVSGASSGVGYGAGYDPATATSPTPTGYGYGAAAPSYAAQPAAQYGTAAAVGTAAAVGTAAGAAAGAVPGTYPQYAAAQSPPLTGLGFQQSPQQQQGPPPAYSNPLTSPVAGTPAAAVAAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQLNKN 3F0AB53EBCC95A5B 3F0AB53EBCC95A5B vrp1_yeast Verprolin VRP1 END5 MDP2 YLR337C L8300.13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGAPAPPPPPPPPALGGSAPKPAKSVMQGRDALLGDIRKGMKLKKAETNDRSAPIVGGGVVSSASGSSGTVSSKGPSMSAPPIPGMGAPQLGDILAGGIPKLKHINNNASTKPSPSASAPPIPGAVPSVAAPPIPNAPLSPAPAVPSIPSSSAPPIPDIPSSAAPPIPIVPSSPAPPLPLSGASAPKVPQNRPHMPSVRPAHRSHQRKSSNISLPSVSAPPLPSASLPTHVSNPPQAPPPPPTPTIGLDSKNIKPTDNAVSPPSSEVPAGGLPFLAEINARRSERGAVEGVSSTKIQTENHKSPSQPPLPSSAPPIPTSHAPPLPPTAPPPPSLPNVTSAPKKATSAPAPPPPPLPAAMSSASTNSVKATPVPPTLAPPLPNTTSVPPNKASSMPAPPPPPPPPPGAFSTSSALSASSIPLAPLPPPPPPSVATSVPSAPPPPPTLTTNKPSASSKQSKISSSSSSSAVTPGGPLPFLAEIQKKRDDRFVVGGDTGYTTQDKQEDVIGSSKDDNVRPSPISPSINPPKQSSQNGMSFLDEIESKLHKQTSSNAFNAPPPHTDAMAPPLPPSAPPPPITSLPTPTASGDDHTNDKSETVLGMKKAKAPALPGHVPPPPVPPVLSDDSKNNVPAASLLHDVLPSSNLEKPPSPPVAAAPPLPTFSAPSLPQQSVSTSIPSPPPVAPTLSVRTETESISKNPTKSPPPPPSPSTMDTGTSNSPSKNLKQRLFSTGGSTLQHKHNTHTNQPDVDVGRYTIGGSNSIVGAKSGNERIVIDDSRFKWTNVSQMPKPRPFQNKTKLYPSGKGSSVPLDLTLFT 24C7522D5B1CA1C8 24C7522D5B1CA1C8 abp1_yeast Actin-binding protein ABP1 YCR88W YCR088W protein protein yeast Saccharomyces cerevisiae Baker's yeast MALEPIDYTTHSREIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTARDEDDLDENELLMKISNAAGARYSIQTSSKQQGKASTPPVKKSFTPSKSPAPVSKKEPVKTPSPAPAAKISSRVNDNNDDDDWNEPELKERDFDQAPLKPNQSSYKPIGKIDLQKVIAEEKAKEDPRLVQKPTAAGSKIDPSSDIANLKNESKLKRDSEFNSFLGTTKPPSMTESSLKNDDDKVIKGFRNEKSPAQLWAERKAKQNSGNAETKAEAPKPEVPEDEPEGEPDVKDLKSKFEGLAASEKEEEEMENKFAPPPKKSEPTIISPKPFSKPQEPVKAEEAEQPKTDYKKIGNPLPGMHIEADNEEEPEENDDDWDDDEDEAAQPPLPSRNVASGAPVQKEEPEQEEIAPSLPSRNSIPAPKQEEAPEQAPEEEIEEEAEEAAPQLPSRSSAAPPPPPRRATPEKKPKENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN 39523510704D94AA 39523510704D94AA myo5-vrp1-8 1 MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VRP1 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a mint A construct bearing the Myo5 Cext (PA-C) pulled down Vrp1-HA but addition of a TH1 domain (PA-TC) blocked the interaction. Further, the presence of the Myo5 neck and 15 amino acids of the N-terminus of the TH1 domain (PA-nTC) recovered Vrp1-HA binding to levels similar to the wild-type (wt) myosin. myo5-cmd1 1 VRP1 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CMD1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3a homomint mint As shown in Figure 3A, addition of calcium significantly reduced Cmd1 association to Myo5 and concomitantly increased the Myo5/Vrp1 interaction. myo5-cmd1-1 1 CMD1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf3b mint myo5-cmd1-2 1 CMD1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:07 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 725-735 fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f8b myo5-rvs167-1 1 MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 705-773 RVS167 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2b mint myo5-cmd1-3 1 VRP1 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CMD1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Phe92Ala MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3b homomint mint myo5-vrp1-9 1 VRP1 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association mint f8d cmd1-myo5-1 4 MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CMD1 5 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf3c myo5-myo5-3 4 MYO5 6 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain physical association physical association mint f2c sf3a f3c f3d myo5-myo5-4 4 MYO5 6 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MYO5 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 725-735 binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf3a mint abp1-myo5-1 3 MYO5 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ABP1 9 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf1a sf2b myo5-cmd1-4 2 MYO5 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CMD1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f2d mint myo5-myo5-5 2 MYO5 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MYO5 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2d mint