MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions mouse-striatum Mus musculus, striatum striatum striatum density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions rat-striatal neurons Rattus norvegicus brain-striatum_neuron striatal neurons fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions mouse-synaptosome Mouse synaptosome synaptosome Synaptosome anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice. EMBO J. (0261-4189) 2010 imex curation Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. Only protein-protein interactions rat-hippocampus_neuron Rattus norvegicus brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Shimokawa N., Haglund K., Hölter SM., Grabbe C., Kirkin V., Koibuchi N., Schultz C., Rozman J., Hoeller D., Qiu CH., Londoño MB., Ikezawa J., Jedlicka P., Stein B., Schwarzacher SW., Wolfer DP., Ehrhardt N., Heuchel R., Nezis I., Brech A., Schmidt MH., Fuchs H., Gailus-Durner V., Klingenspor M., Bogler O., Wurst W., Deller T., de Angelis MH., Dikic I. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation drd2_mouse D(2) dopamine receptor Dopamine D2 receptor Drd2 protein protein mouse Mus musculus Mouse MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC mint This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase 2EC8460CA11FC7F0 sh3k1_human SH3 domain-containing kinase-binding protein 1 SH3KBP1 CIN85 Cbl-interacting protein of 85 kDa Human Src family kinase-binding protein 1 CD2-binding protein 3 protein protein human Homo sapiens Human MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK 3BD350FCDB14BD4C dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 drd2_rat D(2) dopamine receptor Drd2 Dopamine D2 receptor protein protein rat Rattus norvegicus (Rat) Rat MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC DIP protein P61169 original sequence version: 64 216E56CEE5CA32FB dyn2_mouse Dynamin-2 Dynamin UDNM Dnm2 Dyn2 protein protein mouse Mus musculus Mouse MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSGHSPTPQRRPVSSVHPPGRPPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQSVFANNDPFSAPPQIPSRPARIPPGIPPGVPSRRAPAAPSRPTIIRPAEPSLLD E80864AF94B8F778 sh3k1_mouse SH3 domain-containing kinase-binding protein 1 SH3-containing, expressed in tumorigenic astrocytes Regulator of ubiquitous kinase Sh3kbp1 Ruk Seta protein protein mouse Mus musculus Mouse MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDMKKDLLSNKAPEKPMHDVSSGNALLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSRPEGFLPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHRRYYSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQGAGTTERKHEIKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLNRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSALSGILDKDLSDRSNDIDLEGFDSVISSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSKTVTISQVSDNKTSLPPKPGTMAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSTEGKPKMEPAVSSQAAIEELKMQVRELRTIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK AC2DDFB3248A458B syph_rat Synaptophysin Major synaptic vesicle protein p38 Syp protein protein rat Rattus norvegicus (Rat) Rat MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM A245E4F70BF0EAF0 sh3k1_rat SH3 domain-containing kinase-binding protein 1 Sh3kbp1 Ruk Seta SH3-containing, expressed in tumorigenic astrocytes Regulator of ubiquitous kinase protein protein rat Rattus norvegicus (Rat) Rat MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDVKKDLLSNKAPEKPMHDVSSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSRPEGFLPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHRRYYSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLNRPGVLPPRRPERPVGPLTHTRGDSSKIDLAGSTLSGILDKDLSDRSNDIDLEGFDSVISSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVSDNKASLPPKPGTMAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSAEGKAKTESAVSSQAAIEELKMQVRELRTIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK mint Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor (By similarity). Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis B995308497072064 sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD dlg4_mouse Disks large homolog 4 Dlg4 Dlgh4 Psd95 Postsynaptic density protein 95 Synapse-associated protein 90 protein protein mouse Mus musculus Mouse MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKIIEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFHFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein Q62108 original sequence version: 84 DIP protein Q62108 original sequence version: 110 DIP protein Q62108 original sequence version: 109 DIP protein Q62108 original sequence version: 133 7EFFC99E1FFF90BA drd2-dlg4 6 Drd2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Psd95 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Dynamin 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association F5F homomint mint dlg4-sh3kbp1 6 Psd95 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level CIN85 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5E homomint mint dnm2-sh3kbp1 6 CIN85 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Dynamin 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5E homomint mint drd2-sh3kbp1 6 D2DR 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level CIN85 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5E homomint mint drd2-sh3kbp1-1 5 CIN85 15 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Drd2 11 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4d homomint mint dlg4-sh3kbp1-1 7 CIN85 15 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell PSD95 10 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f1b homomint mint sh3kbp1-syp 7 CIN85 15 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Synaptophysin 14 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f1b homomint mint dlg4-sh3kbp1-2 4 CIN85 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Psd95 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F1d homomint mint sh3kbp1-sqstm1 3 CIN85 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p62 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint domino mint sf8 dlg4-sh3kbp1-3 1 CIN85 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Psd95 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization homomint mint F1e sh3kbp1-sqstm1-1 2 p62 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CIN85 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint domino mint sf8 sh3kbp1-sqstm1-2 2 CIN85 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain p62 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint domino mint sf8 sh3kbp1-sqstm1-3 2 CIN85 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain p62 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint domino mint sf8