IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A bivalent tarantula toxin activates the capsaicin receptor, TRPV1, by targeting the outer pore domain. A bivalent tarantula toxin activates the capsaicin receptor, TRPV1, by targeting the outer pore domain. Cell (0092-8674) 2010 imex curation Bohlen CJ., Priel A., Zhou S., King D., Siemens J., Julius D. There was a discrepency between the organism as described in the paper, and in the EMBL sequence submission. This has been corrected in the UniProt entry. jan.siemens@mdc-berlin.de, julius@cmp.ucsf.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bohlen CJ., Priel A., Zhou S., King D., Siemens J., Julius D. There was a discrepency between the organism as described in the paper, and in the EMBL sequence submission. This has been corrected in the UniProt entry. jan.siemens@mdc-berlin.de, julius@cmp.ucsf.edu Accepted 2010-JUL-30 by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation dktx_cyrsc Tau-theraphotoxin-Hs1a Double-knot toxin protein protein hapsc Haplopelma schmidti Chinese bird spider Ornithoctonus huwenum DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND DIP protein P0CH43 original sequence version: 16 8610FE914B72EAE3 trpv1_rat Transient receptor potential cation channel subfamily V member 1 Trpv1 Vr1 Vr1l Osm-9-like TRP channel 1 Vanilloid receptor 1 Vanilloid receptor type 1-like Capsaicin receptor protein protein rat Rattus norvegicus (Rat) Rat MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASPLDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGKNNSLPMESTPHKCRGSACKPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAFRSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSGRVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK DIP protein O35433 original sequence version: 118 DIP protein O35433 original sequence version: 142 DAFC80B12BDF71BF tkdx-trpv1 1 2 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O35433:p.Ala657Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A P Wed May 02 16:13:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala657pro' Tue Jun 30 17:21:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala657Pro' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association To assess binding directly, we immobilized histidine-tagged recombinant DkTx on nickel resin and asked whether this toxin affinity column could retain purified TRPV1 protein. Figs. 5A and 5C