IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Proteomics (1615-9853) 2010 imex curation Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions rat-mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line This line expresses GHS-R1a. It was hybridised from the murine neuroblastoma-glioma N18TG2 with rat mesencephalic neurons. It is a stable inter-species hybrid. pull down pull down western blot western blot Immuno blot Immuno blot Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Alzheimers - Interactions investigated in the context of Alzheimers disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu Accepted 2010-OCT-3 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Proteomics (1615-9853) 2010 jyoti Only protein-protein interactions imex curation Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Proteomics (1615-9853) 2010 imex curation Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions rat-mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line This line expresses GHS-R1a. It was hybridised from the murine neuroblastoma-glioma N18TG2 with rat mesencephalic neurons. It is a stable inter-species hybrid. peptide array peptide array sequence tag sequence tag identification sequence tag Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Alzheimers - Interactions investigated in the context of Alzheimers disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu Accepted 2010-OCT-3 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Proteomics (1615-9853) 2010 jyoti Only protein-protein interactions imex curation Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein. Proteomics (1615-9853) 2010 imex curation Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions rat-mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line mes23_5 Rat -Mouse interspecies hybrid MES23.5; dopaminergic neuroblastoma/glioma cell line This line expresses GHS-R1a. It was hybridised from the murine neuroblastoma-glioma N18TG2 with rat mesencephalic neurons. It is a stable inter-species hybrid. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Liu J., Shi M., Hong Z., Zhang J., Bradner J., Quinn T., Beyer RP., Mcgeer PL., Chen S., Zhang J. Alzheimers - Interactions investigated in the context of Alzheimers disease "After two independent runs were combined, 127 proteins were identified on the basis of ~2 unique peptides. The complete list of identified proteins is shown in Supporting Information Table 3." I looked at S.I. Table 3 and there are many more than 127 lines (a few hundred?) of multiple protein entries ; and there appear to be multiple entrys for the same protein. It is beyond my capability/desire to decipher and enter this info. Also the Abstract states: "In peptide array analysis, 127 proteins were identified as POSSIBLY (my capitals) interacting with eSNCA.". - so the authors are not certain about the "validity" of these interactions, so I am not even considering entering them - or asking anyone else to?? (any volunteers?) (SILAC labeling of MES cells was carried out). Biotinylated enriched membranous proteins were incubated with the SNCA peptide array membrane, incubated with avidin-HRP and visualised using ECL. Identification and quantification of peptides was by large scale 2-D LC-MS/MS analysis. chen_sd@medmail.com.cn, zhangj@u.washington.edu Accepted 2010-OCT-3 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Proteomics (1615-9853) 2010 jyoti Only protein-protein interactions imex curation q9d586_mouse Ig-like domain-containing protein Cntfr protein protein mouse Mus musculus Mouse MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLAGLQSP C22AE303F71C6780 tcph_mouse T-complex protein 1 subunit eta Cct7 Ccth CCT-eta protein protein mouse Mus musculus Mouse MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMMLDELLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALVPDVLGHCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQARFH 0BD7AD35456EE677 vapa_mouse Vesicle-associated membrane protein-associated protein A 33 kDa VAMP-associated protein Vapa Vap33 protein protein mouse Mus musculus Mouse MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL FE8F956C1F2C71CA 4f2_mouse 4F2 cell-surface antigen heavy chain Slc3a2 Mdu1 Solute carrier family 3 member 2 protein protein mouse Mus musculus Mouse MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRDAGGIAGLKSHLEYLSTLKVKGLVLGPIHKNQKDEINETDLKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWFLPAQADIVATKMKEALSSWLQDGVDGFQFRDVGKLMNAPLYLAEWQNITKNLSEDRLLIAGTESSDLQQIVNILESTSDLLLTSSYLSNSTFTGERTESLVTRFLNATGSQWCSWSVSQAGLLADFIPDHLLRLYQLLLFTLPGTPVFSYGDELGLQGALPGQPAKAPLMPWNESSIFHIPRPVSLNMTVKGQNEDPGSLLTQFRRLSDLRGKERSLLHGDFHALSSSPDLFSYIRHWDQNERYLVVLNFRDSGRSARLGASNLPAGISLPASAKLLLSTDSARQSREEDTSLKLENLSLNPYEGLLLQFPFVA AE6261F11C7D9468 mbb1a_mouse Myb-binding protein 1A Mybbp1a P160 Myb-binding protein of 160 kDa protein protein mouse Mus musculus Mouse MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLRTRPNDSEMKYALKRLITGLGVGREAARPCYSLALAQLLQSFEDIPLCDILDQIQEKYSLQAMNKAMMRPSLFANLFGVLALFQSGRLVKDKEALMKSVQLLKILSQHPNHLQGQPIKALVDILSEVPESMFQEILPKVLKGNMKVILRSPKYLELFLLAKQRVPTKLESLMGSVDLFSEDNIPSLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFELFWKKVLEEGLLKNPSWTSSYMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISKPQNLFKIIPEISTYVGTFLEGCQDDPKRQLTMMVAFTTITNQGLPVMPTFWRVTRFLNAEALQSYVAWLRDMFLQPDLNSLVDFSTANQKRAQDASLNVPERAVFRLRKWIIHRLVSLVDHLHLEKDEAVVEQIARFCLFHAFFKTKKATPQIPETKQHFSFPLDDRNRGVFVSAFFSLLQTLSVKFRQTPDLAENGKPWTYRLVQLADMLLNHNRNVTSVTSLTTQQRQAWDQMMSTLKELEARSSETRAIAFQHLLLLVGLHIFKSPAESCDVLGDIQTCIKKSMEQNPRRSRSRAKASQEPVWVEVMVEILLSLLAQPSNLMRQVVRSVFGHICPHLTPRCLQLILAVLSPVTNEDEDDNVVVTDDADEKQLQHGEDEDSDNEDNKNSESDMDSEDGEESEEEDRDKDVDPGFRQQLMEVLKAGNALGGVDNEEEEELGDEAMMALDQNLASLFKEQKMRIQARNEEKNKLQKEKKLRRDFQIRALDLIEVLVTKQPEHPLILELLEPLLNVIQHSMRSKGSTKQEQDLLHKTARIFMHHLCRARRYCHEVGPCAEALHAQVERLVQQAGSQADASVALYYFNASLYLLRVLKGNTNKRHQDGHKLHGADTEDSEDQAANCLDLDFVTRVYSASLESLLTKRNSSLTVPMFLSLFSRYPVICKNLLPVLAQHVAGPSRPRHQAQACLMLQKTLSARELRVCFEDPEWEQLITQLLGKATQTLQTLGEAQSKGEHQKELSILELLNTLLRTVNHEKLSVDLTAPLGVLQSKQQKLQQSLQQGNHSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQDAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNPTLSPSTPAKTPKLQKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLVSRSPSLLQSGVKKRRVASRRVQTP DIP protein Q7TPV4 original sequence version: 72 64D3420981CD0767 m0r757_rat Elongation factor 1-alpha LOC100911991 LOC100360413 protein protein rat Rattus norvegicus (Rat) Rat MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSLKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEVAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK 1F03C919E6141B6F hs90b_mouse Heat shock protein HSP 90-beta Heat shock 84 kDa Tumor-specific transplantation 84 kDa antigen Hsp90ab1 Hsp84 Hsp84-1 Hspcb protein protein mouse Mus musculus Mouse MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD CE323E81CE173ECB cntfr_rat Ciliary neurotrophic factor receptor subunit alpha Cntfr protein protein rat Rattus norvegicus (Rat) Rat MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGTDVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLSAPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSNGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELSSGGGPSIPFLTSVPVTLVLAAAAATANNLLI 3B87EE63923FB149 ef1a1_mouse Elongation factor 1-alpha 1 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Eef1a1 Eef1a protein protein mouse Mus musculus Mouse MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK DIP protein P10126 original sequence version: 149 71072871DE7405DC ef1a1_rat Elongation factor 1-alpha 1 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Eef1a1 Eef1a protein protein rat Rattus norvegicus (Rat) Rat MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK 71072871DE7405DC hs90b_rat Heat shock protein HSP 90-beta Heat shock 84 kDa Hsp90ab1 Hsp84 Hspcb protein protein rat Rattus norvegicus (Rat) Rat MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD CE323E81CE173ECB syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 cntfr_mouse Ciliary neurotrophic factor receptor subunit alpha Cntfr protein protein mouse Mus musculus Mouse MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSILFLTSVPVTLVLAAAAATANNLLI 0704AA35CF1BBE12 vapa_rat Vesicle-associated membrane protein-associated protein A Vapa Vap33 33 kDa VAMP-associated protein protein protein rat Rattus norvegicus (Rat) Rat MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9Z270 original sequence version: 74 A30D08E31F3379C1 q71lx8_mouse Hsp90ab1 Hsp84b Hspcb protein protein mouse Mus musculus Mouse MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD CE323E81CE173ECB snca_biotin 2 10 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) association association (bait) snca was found to be expr. in E. coli - from rPeptide web site. Table 2. snca-cntr 3 11 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization I have entered both Rat and Mouse CNTFR-a as both are most likely detected (hybrid cell line). Fig 4A. Rat and Mouse CNTFR-a as both are most likely detected since a hybrid cell line was used cntfr-snca 1 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association I have entered, as BAITS, both Rat and Mouse CNTFR-a; as the bead coupled antibody will detect both. There will be an error message generated in the Sanity Check - but I think this is a case where 2 baits could be entered with some validity... Fig 4B. snca-cntfr 1 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association I have entered as prey both Rat and Mouse CNTFR-a - hybrid cell line. Fig 4B.