IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro nucl ac uv crosslink nucleic acid uv cross-linking assay nucl ac uv crosslink western blot western blot Immuno blot Immuno blot Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. I think the "32D-Flag-E2" entity is meant to be "32Dcl3 (not expressing anything other than flag-E2/Pbc2) cells". 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro nucl ac uv crosslink nucleic acid uv cross-linking assay nucl ac uv crosslink western blot western blot Immuno blot Immuno blot Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts. Cell (0092-8674) 2010 imex curation Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eiring AM., Harb JG., Neviani P., Garton C., Oaks JJ., Spizzo R., Liu S., Schwind S., Santhanam R., Hickey CJ., Becker H., Chandler JC., Andino R., Cortes J., Hokland P., Huettner CS., Bhatia R., Roy DC., Liebhaber SA., Caligiuri MA., Marcucci G., Garzon R., Croce CM., Calin GA., Perrotti D. 32D-BCR/ABL cells expressing miR-181b were used. 32D-BCR/ABL cells expressing miR-181b were used. Source of PCBP2 taken from PMID:11753385 as detailed in the text. danilo.perrotti@osumc.edu Accepted 2010-MAY-29 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cell (0092-8674) 2010 orchard Only protein-protein interactions imex curation mir-328probe miR RNA probe rna ribonucleic acid RNA rna human Homo sapiens Human CUGGCCCUCUCUGCCCUUCCGU sequence is the same in human and mouse. 2895F6928FEAD13D cebpa-uorf CEBPA uORF RNA probe rna ribonucleic acid RNA rna mouse Mus musculus Mouse CUGGCCAUGCCGGGAGAACUCUAACUCCCCCAUGGAG 1FAA925D76CD8458 trbp2_mouse RISC-loading complex subunit TARBP2 Tarbp2 Prbp TAR RNA-binding protein 2 Protamine-1 RNA-binding protein protein protein mouse Mus musculus Mouse MSEEDQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSLLDSSPPEDTPVVAAEAAAPVPSAVLTRSPPMEMQPPVSPQQSECNPVGALQELVVQKGWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPDDDHFSIGVSSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSVGSLGALGSACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCYGSATTREAARGDAAHRALQYLRIMAGSK 220A1D10D71CC249 cebpa_mouse CCAAT/enhancer-binding protein alpha Cebpa Cebp protein protein mouse Mus musculus Mouse MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAAGLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA DIP protein P53566 original sequence version: 127 DIP protein P53566 original sequence version: 119 DIP protein P53566 original sequence version: 139 1E6CC09A330BEFEF dicer_mouse Endoribonuclease Dicer Dicer1 Dicer Mdcr Double-strand-specific ribonuclease mDCR-1 protein protein mouse Mus musculus Mouse MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELAHQIRGDLNPHAKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSDLEVNASWTKERWSQEFTKHQVLIMTCYVALTVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCESCPSCPRILGLTASILNGKCDPEELEEKIQKLERILRSDAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEAALDFINDCNVAVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTLLRKIHALCEEYFSPASLDLKYVTPKVMKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRSKQMEAEFRKQEEVLRKFRAHETNLLIATSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSADGAEADVHAGVDDEDAFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMDSVRLAERVVALICCEKLHKIGELDEHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPKPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSQQMLELITRLHQYIFSHILRLEKPALEFKPTGAESAYCVLPLNVVNDSGTLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPVDFRYPNLDFGWKKSIDSKSFISTCNSSLAESDNYCKHSTTVVPEHAAHQGATRPSLENHDQMSVNCKRLPAESPAKLQSEVSTDLTAINGLSYNKNLANGSYDLVNRDFCQGNQLNYFKQEIPVQPTTSYPIQNLYNYENQPKPSNECPLLSNTYLDGNANTSTSDGSPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNSEKWEKDEMTKDCLLANGKLGEACEEEEDLTWRAPKEEAEDEDDFLEYDQEHIQFIDSMLMGSGAFVRKISLSPFSASDSAYEWKMPKKASLGSMPFASGLEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQQKSLSGSCAAPVGPRSSAGKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS DIP protein Q8R418 original sequence version: 123 DIP protein Q8R418 original sequence version: 60 DIP protein Q8R418 original sequence version: 101 D97EA17922D7E79C pcbp2_mouse Poly(rC)-binding protein 2 Alpha-CP2 Putative heterogeneous nuclear ribonucleoprotein X CTBP Pcbp2 Cbp Hnrnpx Hnrpx protein protein mouse Mus musculus Mouse MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS 70C8AF710E3BF3C0 ago2_mouse Protein argonaute-2 Ago2 Argonaute RISC catalytic component 2 Eif2c2 Eukaryotic translation initiation factor 2C 2 Kiaa4215 Piwi/argonaute family protein meIF2C2 Protein slicer protein protein mouse Mus musculus Mouse MYSGAGPVLASPAPTTSPIPGYAFKPPPRPDFGTTGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q8CJG0 original sequence version: 61 DIP protein Q8CJG0 original sequence version: 83 A4E13C633846062C mir-328_mouse_gene gene gene mouse Mus musculus Mouse human/mouse-conserved C/EBPa-binding sites. pcbp2_human Poly(rC)-binding protein 2 PCBP2 Alpha-CP2 Heterogeneous nuclear ribonucleoprotein E2 protein protein human Homo sapiens Human MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS 43F035D76FDC2C63 mir-328 miR-328 non coding RNA, full length transcript rna ribonucleic acid RNA rna mouse Mus musculus Mouse cebpa_mrna CDBPA full length mRNA rna ribonucleic acid RNA rna mouse Mus musculus Mouse mut-mir328 Mutant miR RNA probe (mutated seed sequence) rna ribonucleic acid RNA rna human Homo sapiens Human CAUUCCCGCUCUGCCCUUCCGU seed sequence differs from non-mutant form 2895E88D74D007E7 mir328-pcbp2 13 24 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component association association A 32P-labeled miR-328 oligoribonucleotide efficiently formed a complex with recombinant, endogenous, and ectopic hnRNP E2 proteins. The mobility of hnRNP E2:miR-328 complexes was identical to that formed using the uORF/spacer region of CEBPA mRNA (CEBPA uORF) oligoribonucleotide, and miR-328 binding to hnRNP E2 was four times stronger than that of CEBPA uORF. CEBPA uORF Fig 2A. cebpa-pcbp2 13 17 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association mir-328 miR-328 binding to hnRNP E2 was four times stronger than that of CEBPA uORF. Fig 2A. mir328-pcbp2-1 1 21 unspecified role unspecified role neutral component neutral component mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. 17 competitor competitor competitor neutral component neutral component 16 unspecified role unspecified role neutral component neutral component association association A 32P-labeled miR-328 oligoribonucleotide efficiently formed a complex with recombinant, endogenous, and ectopic hnRNP E2 proteins. The mobility of hnRNP E2:miR-328 complexes was identical to that formed using the uORF/spacer region of CEBPA mRNA (CEBPA uORF) oligoribonucleotide, and miR-328 binding to hnRNP E2 was four times stronger than that of CEBPA uORF. CEBPA uORF Fig 2A. Imatinib, an inhibitor of the TK (tyrosine kinase) domain in abl (the Abelson proto-oncogene), c-kit and PDGF-R. cebpa-pcbp2-1 1 16 competitor competitor competitor neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. association association I added as neutral components as some existing entires were bait/prey and some the same as I have entered -it was not obvious which is correct for this entry.] mir-328 could be entered as an interactor or as an Antagonist - both entered, as I am not sure which was best way to enter. mir-328 Fig 2A. Imatinib, an inhibitor of the TK (tyrosine kinase) domain in abl, c-kit and PDGF-R. mir328-pcbp2-2 2 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait physical association physical association A 32P-labeled miR-328 oligoribonucleotide efficiently formed a complex with recombinant, endogenous, and ectopic hnRNP E2 proteins. Fig 2B. cebpa-pcbp2-2 2 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association Fig 2B. A 32P-labeled miR-328 oligoribonucleotide efficiently formed a complex with recombinant, endogenous, and ectopic hnRNP E2 proteins. mut-mir328-pcbp2-3 7 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait physical association physical association Mutant miR-328 binds both endogenous and ectopic hnRNP E2 at higher affinity than wild-type miR-328, suggesting that the C-rich character rather than the seed sequence is important for hnRNP E2 interaction. Fig 2B. cebpa-pcbp2-3 7 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association Fig 2B. A 32P-labeled miR-328 oligoribonucleotide efficiently formed a complex with recombinant, endogenous, and ectopic hnRNP E2 proteins. mut-mir328-pcbp2-4 2 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait physical association physical association Mutant miR-328 binds both endogenous and ectopic hnRNP E2 at higher affinity than wild-type miR-328, suggesting that the C-rich character rather than the seed sequence is important for hnRNP E2 interaction. Fig 2B. mir328-pcbp2-3 12 25 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig 2C. Imatinib, an inhibitor of the TK (tyrosine kinase) domain in abl, c-kit and PDGF-R. Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. I have added 2 X refs for miR-328 as i was not sure which was the right one - no protein link. One is for the transcript, the other for the gene (I think). [this is now generating an error message in talisman....) mir328-pcbp2-4 5 24 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey physical association physical association Fig S1C. Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. mir328-pcbp2-5 8 24 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey physical association physical association Fig S1C. Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. cebpa-pcbp2-7 9 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig 2D, 2E. Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. miR-328 binding to hnRNP E2 impaired hnRNP E2:CEBPA association. mir328-pcbp2-7 14 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. 25 unspecified role unspecified role prey prey physical association physical association Fig 2D. Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. miR-328 binding to hnRNP E2 impaired hnRNP E2:CEBPA association. cebpa-pcbp2-8 14 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig 2E (very faint band visible). Ectopic expression of miR-328 at physiological levels also resulted in complex formation with both ectopic and endogenous hnRNP E2. miR-328 binding to hnRNP E2 impaired hnRNP E2:CEBPA association. cebpa-pcbp2-9 10 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig 2E. Ectopic miR-181b neither interacted with hnRNP E2 nor significantly altered levels of the hnRNP E2:CEBPA complex. mir328-pcbp2-8 7 24 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait physical association physical association Fig 2E. Ectopic miR-181b (and miR-330) did neither interact with hnRNP E2 nor significantly alter levels of the hnRNP E2:CEBPA complex. Thus, miR-328 specifically competes with CEBPA mRNA for binding to hnRNP E2. cebpa-pcbp2-10 15 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. 26 unspecified role unspecified role prey prey physical association physical association Fig S1D, 5D. Association of miR-328 and CEBPA mRNA to endogenous hnRNP E2 in anti-hnRNP E2 RIPs from empty vector- and miR-328-expressing 6.15 and 6.15-uORF cells. miR-328 expression and, therefore, formation of the hnRNP E2:miR-328 complex markedly decreased levels of the hnRNP E2-bound CEBPA mRNA. mir328-pcbp2-9 3 25 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig S1D, 5D. Association of miR-328 and CEBPA mRNA to endogenous hnRNP E2 in anti-hnRNP E2 RIPs from empty vector- and miR-328-expressing 6.15 and 6.15-uORF cells. mir328-pcbp2-10 4 25 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association S1D. Association of miR-328 and CEBPA mRNA to endogenous hnRNP E2 in anti-hnRNP E2 RIPs from empty vector- and miR-328-expressing 6.15 and 6.15-uORF cells. cebpa-pcbp2-11 3 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig S1D, 5D. Association of miR-328 and CEBPA mRNA to endogenous hnRNP E2 in anti-hnRNP E2 RIPs from empty vector- and miR-328-expressing 6.15 and 6.15-uORF cells. miR-328 expression and, therefore, formation of the hnRNP E2:miR-328 complex markedly decreased levels of the hnRNP E2-bound CEBPA mRNA. very faint band - I only can see it (or imagine it) on the magnified image...(for S1D) trbp2-pcbp2-12 6 18 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait mouse-32dcl3 Mus musculus 32Dcl3 murine myeloid cell line dependent on IL3. 32dcl3 32Dcl3 murine myeloid cell line dependent on IL3. One of the few cell lines that can terminally differentiate into neutrophils. An interleukin-3 (IL-3)-dependent cell line. physical association physical association Fig 3A. An evaluation as to whether hnRNP E2 is in complex with Dicer, Ago2, or TRBP2. There is clearly a band visible here (without magnification), in spite of the text stating "coimmunoprecipitation (coIP) experiments clearly show that hnRNP E2 did not interact with Dicer, TRBP2, or Ago2."... So should this interaction be deleted? trbp2-dicer 6 20 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 3B. TRBP2 was readily detectable in anti-Dicer IPs. mir328-dicer 4 25 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 3C, lane 4. RIP assays revealed miR-328 in complex with both Dicer and Ago2. mir328-pcbp2-11 4 21 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Fig 3C, lane 5. The presence of readily detectable hnRNP E2:miR-328 complex in RIP assays on Dicer-immunodepleted lysates suggests that miR-328 might interact with hnRNP E2 in a RISC-independent manner. mir328-dicer-1 4 22 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Fig 3C, lane 7. RIP assays revealed miR-328 in complex with both Dicer and Ago2. cepba-mir_p 11 23 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6C. Physical interaction between HA-CEBPa and the miR-328 promoter region was detected at regions -1119 to -1112 and -565 to -557. These are mouse/human conserved CEBPa-binding sites.