IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Cell (0092-8674) 2009 imex curation Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 3 mouse-ovary Mouse ovary ovary Ovary fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de Accepted 2010-MAR-9 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 3 imex curation Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Cell (0092-8674) 2009 imex curation Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de Accepted 2010-MAR-9 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 3 imex curation Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Somatic sex reprogramming of adult ovaries to testes by FOXL2 ablation. Cell (0092-8674) 2009 imex curation Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de 29-Mar-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 3 mouse-ovary Mouse ovary ovary Ovary ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Uhlenhaut NH., Jakob S., Anlag K., Eisenberger T., Sekido R., Kress J., Treier AC., Klugmann C., Klasen C., Holter NI., Riethmacher D., Schutz G., Cooney AJ., Lovell-Badge R., Treier M. treier@embl.de Accepted 2010-MAR-9 by JYOTI. 29-Mar-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 3 imex curation esr2_mouse Estrogen receptor beta Esr2 Estrb Nr3a2 Nuclear receptor subfamily 3 group A member 2 protein protein mouse Mus musculus Mouse MEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVNRETLKRKLGGSGCASPVTSPSAKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSASEQVHCLNKAKRTSGHTPRVKELLLNSLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTARFRELKLQHKEYLCVKAMILLNSSMYPLATASQEAESSRKLTHLLNAVTDALVWVISKSGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECCSTEDSKSKEGSQNLQSQ BEFA25F62650A8D4 sox9_mouse Transcription factor SOX-9 Sox9 Sox-9 protein protein mouse Mus musculus Mouse MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQAGKVDLKREGRPLAEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAPTPATAGHVWMSKQQAPPPPPQQPPQAPQAPQAPPQQQAPPQQPQAPQQQQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQISYSPFNLPHYSPSYPPITRSQYDYADHQNSGSYYSHAAGQGSGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP 01FC3B54FF329BDA esr1_mouse Estrogen receptor Esr1 Esr Estr Estra Nr3a1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein mouse Mus musculus Mouse MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI 05F5E2FC21CC0A8B sox9_mouse_gene Mouse Sox9 gene gene gene mouse Mus musculus Mouse dmrt1_mouse Doublesex- and mab-3-related transcription factor 1 Dmrt1 protein protein mouse Mus musculus Mouse MPNDDTFGKPSTPTEVPHAPGAPPQGKAGGYSKAAGAMAGAAGGSGAGGSGGASGSGPSGLGSGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASEGRMVIQDIPAVTSRGHMENTSDLVSDPAYYSSFYQPSLFPYYNNLYNYPQYSMALSAESSSGEVGNSLGGSPVKNSLRSLPAPYVPAQTGNQWQMKTSESRHPVSSQYRMHSYYGPPSYLGQSMSQIFTFEEGPSYSEAKASVFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEEDEDE B6C4601432007C35 foxl2_mouse Forkhead box protein L2 Foxl2 Pfrk Pituitary forkhead factor protein protein mouse Mus musculus Mouse MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL F920C8407686C4B6 foxl2-sox9_gene-1 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association With Foxl2HAFoxl2 ovaries we obtained a 6-fold enrichment using primers that spanned TESCO and a 7-fold enrichment around the Sox9 transcription start site compared to wild-type ovaries Fig. 5C FOXL2 binds to the cis-regulatory element for testis-specific Sox9 expression, referred to as TESCO. esr1-sox9_gene-1 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association ChIP analysis demonstrates ESR1 binding to TESCO sequences in adult ovaries. Fig. 6A ESR1 binds to the cis-regulatory element for testis-specific Sox9 expression, referred to as TESCO. foxl2-esr1 2 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Coimmunoprecipitation of Flag-tagged FOXL2 and V5-tagged nuclear hormone receptors from HEK293 cells demonstrating a strong physical interaction between FOXL2 and ESR1 or ESR2. Fig. 6D foxl2-esr2-1 2 4 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Coimmunoprecipitation of Flag-tagged FOXL2 and V5-tagged nuclear hormone receptors from HEK293 cells demonstrating a strong physical interaction between FOXL2 and ESR1 or ESR2. Fig. 6D sox9-dmrt1-1 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization SOX9 and DMRT1 co-immunostaining Supp. Fig. 10