MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. EMBO J. (0261-4189) 2009 imex curation Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. EMBO J. (0261-4189) 2009 imex curation Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. EMBO J. (0261-4189) 2009 imex curation Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. EMBO J. (0261-4189) 2009 imex curation Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. EMBO J. (0261-4189) 2009 imex curation Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation cdc53_yeast Cell division control protein 53 CDC53 YDL132W D2190 Cullin-A E3 ubiquitin ligase complex SCF subunit CDC53 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCVNKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQVTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFVVLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIAAAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 22BC8B35034EDDEF 22BC8B35034EDDEF skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 746DDE6470A69432 dcn1_yeast Defective in cullin neddylation protein 1 L3111 YLR128W DCN1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ CBD829C941466180 rbx1_yeast RING-box protein HRT1 E3 ubiquitin-protein ligase complex SCF subunit HRT1 High level expression reduces Ty3 transposition protein 1 HRT1 RBX1 ROC1 Regulator of cullins protein 1 YOL133W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR A9C3193E48CAF881 A9C3193E48CAF881 rub1_yeast NEDD8-like protein RUB1 RUB1 YDR139C Ubiquitin-like protein RUB1 YD9302.15C Related to ubiquitin protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLVLTLRGGN F05DBF3C8E464FD1 F05DBF3C8E464FD1 lag2_yeast Cullin-associated NEDD8-dissociated protein 1 homolog LAG2 CAND1 homolog Longevity-assurance protein 2 YOL025W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLHISKLIEQYRSTKDNDLKYMLLRQNFKINDIEDELAPLVNELLLPVLVEEQDMEILNLVSFQVLPDLVLSMISDPAAAQLGWVISLICDPLLNQSMIHANRSFVLIETLRNVLQKIENSPHLDYHQPVNSSLEFISKFIVEMKRHMCDVDAAQLSHSLSESNMLIYIESLNLLLKFSFFSDAASPSVMVTLPFDILNDVFTIAQDYSATNTNESIDRITEKLLLTSTQLTHPVDLENLCPKMKYNTLAAVSRIWYKFGPIVDKLFTNRLLPVLFPPQMGEECNVEDVLEIVHNFHPYFSIRRLKDNRPLLSDSTISQLREGLFGMLSILNDSLTRTQNENDHGSDNLIDSDDGFGSDNDPEQQAYLDELVSEGYDENMYDGDTDDEDADDINVEKNDEATKDITETNKILLIFSELHYPQEERFSELLVELQTKIAINTSLIDKILSKETTELPTHNGEIADLNEILNEVKGNKPIRKNVIFCTLAHTLSLQSGSELSVLQLSIEVIDHLLVKNHSNNITRGEQFQLIKLILPHLKTNKSFIDTLKAGNFTQKIDEGVTLRTMILSLLLQLFPLDYSMLGEILPTIARYSVRDKDLGVRDLSFQLLDQILRTYYNYLIGIDWEWYKDDFYQVLQETCIKKDINTNLLLQFPPYLPHD C5B8483C3BD758C1 skp1-cdc53 2 SKP1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint fs2b lag2-cdc53-1 2 LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association mint f1c f1b Lag2 preferentially co-immunoprecipitated non-neddylated Cdc53, even though the majority of Cdc53 in cells is neddylated (Figure 1C). lag2-cdc53-2 2 CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q92325:p.Gly551Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:51:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:02:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly551ala' Tue Jun 30 15:36:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly551Ala' Q92325:p.Asn552Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:11:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:38:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn552ala' Tue Jun 30 15:38:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn552Ala' physical association physical association f1d mint lag2-cdc53-3 2 CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q92325:p.Met23Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain M A Tue Jul 12 10:09:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:49:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met23ala' Tue Jun 30 16:32:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met23Ala' Q92325:p.Asp19Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:51:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:01:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp19ala' Tue Jun 30 15:44:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp19Ala' Q92325:p.Asp17Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:51:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:17:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp17ala' Tue Jun 30 17:29:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp17Ala' Q92325:p.Tyr22Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:09:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:04:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr22ala' Tue Jun 30 19:41:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr22Ala' physical association physical association f1d mint lag2-cdc53-4 2 LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f5c mint cdc53-lag2-1 3 LAG2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CDC53 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association mint fs2a cdc53-hrt1-2 5 HRT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified association association f3a homomint mint cdc53-dcn1 4 LAG2 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified CDC53 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DCN1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain association association homomint mint fs5a rub1-cdc53 1 RUB1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LAG2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level neddylated lysine neddylated lysine neddylated lysine neddylated lysine western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm CDC53 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f4b homomint mint HA-immunoprecipitates (IP) from extracts prepared from rub1D cells transformed with either an empty HA-vector (HA) or a plasmid expressing HA-tagged Rub1 were immunoblotted for the presence of Lag2 (upper panel) or Cdc53 (lower panel) with specific antibodies.