MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. EMBO J. (0261-4189) 2010 imex curation Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. EMBO J. (0261-4189) 2010 imex curation Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. EMBO J. (0261-4189) 2010 imex curation Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. Only protein-protein interactions in vitro In vitro competition binding competition binding weight by comassie molecular weight estimation by coomasie staining weight by comassie Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. EMBO J. (0261-4189) 2010 imex curation Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. EMBO J. (0261-4189) 2010 imex curation Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down weight by staining molecular weight estimation by staining weight by staining Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC B2A8F4E3B0FB17D6 drra_legph Multifunctional virulence effector protein DrrA lpg2464 drrA Defects in Rab1 recruitment protein A sidM protein protein legph Legionella pneumophila subsp. pneumophila MSIMGRIKMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKNDEDIKKVKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEATAMSILTSKPVLPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSVKTHIMRPIDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAMSKRFELHAEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK mint DCE6EC98BCC3CDCA gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ BC283A445E50A652 drra-rab1a 4 SidM/DrrA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Rab1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint st1 f1 sf1 drra-rab1a-1 2 SidM/DrrA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Rab1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint sf2b f6 drra-rab1a-2 2 SidM/DrrA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Rab1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf2b mint drra-rab1a-3 2 SidM/DrrA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A E Tue Jul 12 10:08:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:26:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala435glu' Tue Jun 30 15:46:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala435Glu' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Rab1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3b mint drra-rab1a-4 1 SidM/DrrA 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Rab1 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint sf5 drra-rab1a-5 1 SidM/DrrA 7 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A E Tue Jul 12 10:12:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:13:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala435glu' Tue Jun 30 17:29:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala435Glu' Rab1 6 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association f2d mint drra-rab1a-6 3 SidM/DrrA 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A E Tue Jul 12 10:52:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala435glu' Tue Jun 30 15:35:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala435Glu' Rab1 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association mint f2b f2d f3d rab1a-gdi1 5 GDI1 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Rab1 6 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association homomint mint f2b f2d