MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins. Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins. Biochem. Biophys. Res. Commun. (0006-291X) 2009 Wang R., He H., Sun X., Xu J., Marshall FF., Zhau H., Chung LW., Fu H., He D. rwang2@emory.edu partial coverage rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang R., He H., Sun X., Xu J., Marshall FF., Zhau H., Chung LW., Fu H., He D. rwang2@emory.edu Biochem. Biophys. Res. Commun. (0006-291X) 2009 partial coverage rapid curation 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS DIP protein P31947 original sequence version: 84 7F4B44E3AA59ECE6 tpd53_human Tumor protein D53 Tumor protein D52-like 1 TPD52L1 protein protein human Homo sapiens Human MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC 6B3C336D5C0653C9 sfn-tpd52l1 1 TPD53_HUMAN 3 unspecified role unspecified role unspecified role unspecified role 1433S_HUMAN 2 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint