IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. Genetics (0016-6731) 2008 imex curation Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Accepted 2010-MAR-9 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Genetics (0016-6731) 2008 jyoti Only protein-protein interactions imex curation The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. Genetics (0016-6731) 2008 imex curation Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Accepted 2010-MAR-9 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Genetics (0016-6731) 2008 jyoti Only protein-protein interactions imex curation The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. Genetics (0016-6731) 2008 imex curation Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Accepted 2010-MAR-9 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Genetics (0016-6731) 2008 jyoti Only protein-protein interactions imex curation arp10_yeast Actin-like protein ARP10 ARP10 YD8557.15 YD9727.02 YDR106W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNTIVIVYLGANRIEIGRSADACPQEIIAWKTGSINEKNREELKKIFEHYFQICNILGNREVQVLILEDIFISVVEKRIICSILFKEFDCAHVSFVPRAIVHCLSCNTRNAIVIDIGTNYTTCVPIFDLRPLQQFIKYSKRGKRQVESRIPLPGSLYMPIFFDEEYNSKNCEVDETPVINLVKNIVESLPIDLRRPLRENIIIVNIEEAYETVIRNLFKLKMDTSKIQFPKNYWQAGSACAKILLHYKGSNIVGIERDEFYNNPHIAPDWFDYYFRTGVKRLQ C2EDD2B6D4BE48BD C2EDD2B6D4BE48BD ldb18_yeast Protein LDB18 Low dye-binding protein 18 LDB18 YLL049W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPGLKLVEALEYRCDRLERLIGAGYSANSDVSVQLDELYNQLHRLYFQGLKYSQDLLQLFNTFMAEDIENVGAPDDICIFASCFDDIYTLYSAFDELNSQYMEFCQISKSSLDQISFKDANIETKQLKKLPELVDNCNIMILRSIAILNRFIDWNIEVNGFFQFQKKRLLNLQKVIYST F3932244CFC84895 arp1_yeast Centractin ARP1 ACT3 ACT5 Actin-like protein Actin-related protein 1 YHR129C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQLSDSYALYNQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLEDSTRVYSNLM 98EEA90DC9497B81 jnm1_yeast Nuclear migration protein JNM1 YMR294W JNM1 INS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVIDLSDPAINVDYDSLIGIDNEESQEIFENEVKEDGQQEEQEEASSRKDGLIVEPGRDVESLRRAIRDQLLFKIHRQNQSDCADARKLSNDEEDESRQQKLERIREELEELKIENLTSEMQTEIKELCEIQSKLATESSSRLTNLRKKLLETYEGQDTVILPNIILDTSNIKRLQKLDQKISLMERFVGIPEALEAEEDRKSVHSKVNELYRSIQLLQGDDKAEGKLQKFRDRLVELNEEFENSLLGKKIQQDLRLKDDTVSKLVMPENKVKEINSMYSMFKQYQDSLPLLAERMKSLNKMNNRVIEVYETTKGLDSQITSIQEQGKVWLKALNELDKKFDEQEVKIRENMEQIRRKIDTLEDEALQRNSK 80646B78B484AE56 80646B78B484AE56 nip80_yeast Protein NIP100 YPL174C NIP100 NIP80 Protein NIP80 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRNAGVQVDTNMQKISLQDTVLVNEMKGRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTLQFYKPDDDEHSLLNGNAAQETIKNLQVKCESLASKLNKIKIENHELKTSVEKLSTNETVLLSKISRLDKLVKELKVENGNMKTHLDNFNHLLDASDSVMAPDLDKGTLLERSHLLQGLLDQTKLSYDKAMKVQEDLLEENTQLLEENAVLSKKISDLGLQLQQTNNTIGDLALQIEAQSKSSNIVDKLTNDNILLTSNIKALNNELEELQAKEKLDENLRITYEQLEQELRLQLSNLQSALENEKEIAGTYIEENSRLKATLESIEAKTSHKFQSLELKVNTLQEELYQNKLLKKFYQIYEPFAQPHLAALSSQLQYLAEVIESENFGKLENIEIHIILKVLSSISYALHIYTIKNTPDHLETTLQCFKVNIAPISMWLSEFLQRKFSSKQETAFSICQFLEDNKFLDKDVTLILKILHPILETTVPKLLAFLRTNSNFNDNDTLCLIGSLYERSLSLIARIDKLIGKEEISKQDNRLFLYPSCDITLSSILTILFSDALFLRQDYKRISSLKKLEVFFQGIESLLENITIFPEQPSQQTSDSESQCNIKEGNFSNSLLSDRLNEENIRLKEVLVQKENMLTELETKIKIIIGRDLERKTLEENIKTLKVELNNKNEENCGKTEILNKLKEENFNLVNRLKNMELKLYQIKDNNTLNKIYLDREKVDRVNLVSEIMELRETIRRQIKEQKRVSIDFSWLDELPAVENKQPFKEHINHSLDTLGIEMFNFVSTSRILDLKLDQPLAEDELWHERDHSYISYLKRKRKNIRLKSQNVVTYYK A72EA9E938845081 A72EA9E938845081 ldb18-nip100-1 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Immunoprecipitation of Ldb18 pulls down Nip100, Jnm1, Arp1, and Arp10 Fig. 2B ldb18-nip100-2 1 5 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C Approximately 20 S complex. arp1-jnm1-2 2 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association the interaction between Jnm1 and the Arp1 filament Fig. 5A arp1-jnm1-3 2 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Thus, loss of Ldb18 reduces the Jnm1�Nip100 interaction by ∼95%. Figs. 5B, 5B Interaction is reduced in a ldb18 -/- strain.