MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex. PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex. J. Biol. Chem. (0021-9258) 2007 Fonseca BD., Smith EM., Lee VH., MacKintosh C., Proud CG. rapid curation unknown Unknown far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Fonseca BD., Smith EM., Lee VH., MacKintosh C., Proud CG. J. Biol. Chem. (0021-9258) 2007 rapid curation bmh1_yeast Protein BMH1 YER177W BMH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 0A234167E313688B 0A234167E313688B akts1_human Proline-rich AKT1 substrate 1 40 kDa proline-rich AKT substrate AKT1S1 PRAS40 protein protein human Homo sapiens Human MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY F6CB195CBB54326C akt1s1-bmh1-1 1 AKTS1_HUMAN 3 unspecified role unspecified role unspecified role unspecified role BMH1_YEAST 2 unspecified role unspecified role unspecified role unspecified role association association domino mint akt1s1-bmh1-2 1 AKTS1_HUMAN 3 unspecified role unspecified role unspecified role unspecified role BMH1_YEAST 2 unspecified role unspecified role unspecified role unspecified role association association domino mint