MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Small heat shock protein Hsp20 (HspB6) as a partner of 14-3-3gamma. Small heat shock protein Hsp20 (HspB6) as a partner of 14-3-3gamma. Mol. Cell. Biochem. (0300-8177) 2007 Chernik IS., Seit-Nebi AS., Marston SB., Gusev NB. partial coverage rapid curation unknown Unknown biochemical biochemical predetermined predetermined participant predetermined Chernik IS., Seit-Nebi AS., Marston SB., Gusev NB. Mol. Cell. Biochem. (0300-8177) 2007 partial coverage rapid curation 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D hspb6_human Heat shock protein beta-6 HSPB6 Heat shock 20 kDa-like protein p20 protein protein human Homo sapiens Human MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK 3BFB1FFB5877F2E7 hspb6-ywhag 1 HSPB6_HUMAN 3 unspecified role unspecified role unspecified role unspecified role 1433G_HUMAN 2 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint