MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Single phosphorylation of Tyr304 in the cytoplasmic tail of ephrin B2 confers high-affinity and bifunctional binding to both the SH2 domain of Grb4 and the PDZ domain of the PDZ-RGS3 protein. Single phosphorylation of Tyr304 in the cytoplasmic tail of ephrin B2 confers high-affinity and bifunctional binding to both the SH2 domain of Grb4 and the PDZ domain of the PDZ-RGS3 protein. Eur. J. Biochem. (0014-2956) 2004 Su Z., Xu P., Ni F. SH2 PMID_in_GD partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Su Z., Xu P., Ni F. SH2 PMID_in_GD PMID_in_GD Eur. J. Biochem. (0014-2956) 2004 partial coverage rapid curation Single phosphorylation of Tyr304 in the cytoplasmic tail of ephrin B2 confers high-affinity and bifunctional binding to both the SH2 domain of Grb4 and the PDZ domain of the PDZ-RGS3 protein. Single phosphorylation of Tyr304 in the cytoplasmic tail of ephrin B2 confers high-affinity and bifunctional binding to both the SH2 domain of Grb4 and the PDZ domain of the PDZ-RGS3 protein. Eur. J. Biochem. (0014-2956) 2004 Su Z., Xu P., Ni F. SH2 PMID_in_GD partial coverage rapid curation unknown Unknown peptide array peptide array predetermined predetermined participant predetermined Su Z., Xu P., Ni F. SH2 PMID_in_GD PMID_in_GD Eur. J. Biochem. (0014-2956) 2004 partial coverage rapid curation nck2_mouse Cytoplasmic protein NCK2 Nck2 Grb4 Growth factor receptor-bound protein 4 NCK adaptor protein 2 SH2/SH3 adaptor protein NCK-beta protein protein mouse Mus musculus Mouse MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKNLKDTLGLGKTRRKPSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSFNGQIGWFPSNYVLEEADEAAAEAPSFLSLRRGTALSNGQGARVLHVVQTLYPFSSVTEEELSFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHTPQISYTGPSASGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGRNKHFKVQLVDSVYCIGQRRFHSMDELVEHYKKAPIFTSEHGEKLYLVRALQ 7B3404B976F0A54D efnb2_mouse Ephrin-B2 Elf2 Epl5 Eplg5 Htkl Lerk5 Efnb2 EPH-related receptor tyrosine kinase ligand 5 ELF-2 HTK ligand protein protein mouse Mus musculus Mouse MAMARSRRDSVWKYCWGLLMVLCRTAISRSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRGGNNNGSEPSDVIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV DIP protein P52800 original sequence version: 59 DIP protein P52800 original sequence version: 98 DIP protein P52800 original sequence version: 118 D08894996E399554 efnb2-nck2 1 O55033_MOUSE 3 unspecified role unspecified role unspecified role unspecified role EFNB2_MOUSE 4 unspecified role unspecified role unspecified role unspecified role binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain association association homomint mint efnb2-nck2-1 2 EFNB2_MOUSE 4 unspecified role unspecified role unspecified role unspecified role binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain O55033_MOUSE 3 unspecified role unspecified role unspecified role unspecified role association association homomint mint