IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Association of signal-regulatory proteins beta with KARAP/DAP-12. Association of signal-regulatory proteins beta with KARAP/DAP-12. Eur. J. Immunol 2000 imex curation Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr Accepted 2010-MAR-25 by SKERRIEN. Eur. J. Immunol 2000 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Association of signal-regulatory proteins beta with KARAP/DAP-12. Association of signal-regulatory proteins beta with KARAP/DAP-12. Eur. J. Immunol 2000 imex curation Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr Accepted 2010-MAR-25 by SKERRIEN. Eur. J. Immunol 2000 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Association of signal-regulatory proteins beta with KARAP/DAP-12. Association of signal-regulatory proteins beta with KARAP/DAP-12. Eur. J. Immunol 2000 imex curation Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd rat-rbl_2h3 Rat basophilic leukemia cell line rbl_2h3 Rat basophilic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr Accepted 2010-MAR-25 by SKERRIEN. Eur. J. Immunol 2000 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Association of signal-regulatory proteins beta with KARAP/DAP-12. Association of signal-regulatory proteins beta with KARAP/DAP-12. Eur. J. Immunol 2000 imex curation Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr Accepted 2010-MAR-25 by SKERRIEN. Eur. J. Immunol 2000 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Association of signal-regulatory proteins beta with KARAP/DAP-12. Association of signal-regulatory proteins beta with KARAP/DAP-12. Eur. J. Immunol 2000 imex curation Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Elena Tomasello, Charles Cant, Hans-Jorg Buhring, Frederic Vely, Pascale Andre, Martine Seiffert, Axel Ullrich, Eric Vivier vivier@ciml.univ-mrs.fr Accepted 2010-MAR-25 by SKERRIEN. Eur. J. Immunol 2000 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd ksyk_human Tyrosine-protein kinase SYK SYK Spleen tyrosine kinase p72-Syk protein protein human Homo sapiens Human MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN DIP protein P43405 original sequence version: 146 EAA6BDE65881FC68 tyobp_human TYRO protein tyrosine kinase-binding protein TYROBP DAP12 KARAP DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein human Homo sapiens Human MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK 267CB1C1756F89F0 sirb1_human Signal-regulatory protein beta-1 CD172 antigen-like family member B SIRPB1 protein protein human Homo sapiens Human MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA C9C5E759514E212E ksyk_rat Tyrosine-protein kinase SYK Spleen tyrosine kinase Syk p72Syk protein protein rat Rattus norvegicus (Rat) Rat MAGNAVDNANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPEGLVCLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNNGSFALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGVQMGHPGSSNAHPVTWSPGGIISRIKSYSFPKPGHKKPPPPQGSRPESTVSFNPYEPTGGAWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAAWGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREMYDLMFLCWTYDVENRPGFAAVELRLRNYYYDVVN 81169A643EC6A6FE tyrobp-sirpb1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-term c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 1A As expected, anti-FLAG immunoprecipitates prepared from lysates of KARAP-FLAG and SIRP/KARAP-FLAG-transfected HEK293 cells contained the 12-kDa KARAP-FLAG protein (Fig. 1A) sirpb1-tyrobp 4 7 unspecified role unspecified role prey prey c-term c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait physical association physical association Fig 1B sirpb1-tyrobp-1 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig 4A sirpb1-syk 3 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 4C Anti-SIRPB1 tyrobp-syk 5 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-term c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 2B Pervanadate - phosphatase inhibitor sirpb1-syk-1 1 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey physical association physical association Fig 6B