IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Plant J. (0960-7412) 1997 imex curation Fan HY., Hu Y., Tudor M., Ma H. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Fan HY., Hu Y., Tudor M., Ma H. The authors demonstrated that the K domains of the AGL proteins studied in this report were sufficient to bind to the AG protein. However the authors do not provide the coordinates of these regons and therefore this information could not be curated. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org Accepted 2009-JUN-13 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Plant J. (0960-7412) 1997 imex curation Fan HY., Hu Y., Tudor M., Ma H. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fan HY., Hu Y., Tudor M., Ma H. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org Accepted 2009-JUN-13 by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Plant J. (0960-7412) 1997 imex curation Fan HY., Hu Y., Tudor M., Ma H. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fan HY., Hu Y., Tudor M., Ma H. The authors demonstrated that the K domains of the AGL proteins studied in this report were sufficient to bind to the AG protein. However the authors do not provide the coordinates of these regons and therefore this information could not be curated. To determine whether Gal4-TA fusion proteins encoded by the positive clones interact specifically with AG-KC, we tested the first 191 cDNA library clones for interaction with unrelated fusion proteins of Gal4-DBD with Snfl, Tat, p53 or lamin. Clones expressing Gal4-TA fusion proteins that interacted with the non-specific Gal4-DBD fusion proteins were excluded from the collection. mah@cshl.org Accepted 2009-JUN-13 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Constructed from mRNA isolated from Arabidopsis Landsberg erecta floral buds ranging from stage 1 to stage 12 (stages are defined according to Smyth et aL, 1990. PMID:2152125). Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation q84wb0_arath At3g02310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHVGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML 90136FF0E1A88BC1 q1peu3_arath AGL6 At2g45650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSVGIESTIERYNRCYNCSLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFETEGHAFKTFQDLWANSAASVAGDPNNSEFPVEPSHPNVLDCNTEPFLQIGFQQHYYVQGEGSSVSKSNVAGETNFVQGWVL F763A4A71515CF20 b4f7r9_arath protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI 0057CABD3F1AFC40 ag_arath Floral homeotic protein AGAMOUS F13C5.130 AG At4g18960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV 4E7591AD85654C1C q5xxn8_arath SEP1 At5g15800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML 867906D8D657621E ag-agl2-1 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 The 156 cDNA clones consisted of 21 AGL2, 35 AGL4, 13 AGL6 and 87 AGL9 cDNA fragments. ag-agl4 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 The 156 cDNA clones consisted of 21 AGL2, 35 AGL4, 13 AGL6 and 87 AGL9 cDNA fragments. ag-agl6 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 The 156 cDNA clones consisted of 21 AGL2, 35 AGL4, 13 AGL6 and 87 AGL9 cDNA fragments. The sequence provided by the authors around the binding site of AGL6 is 'NNKKPEE' however the sequence around the binding site in the UniProt record is 'NNKPEE'. ag-agl9 2 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Figure 2 The 156 cDNA clones consisted of 21 AGL2, 35 AGL4, 13 AGL6 and 87 AGL9 cDNA fragments. ag-agl4-1 3 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 As shown in Table 1, although AG-KC bound to AGL2, AGL4, AGL6 or AGL9 more strongly than AG-K(amino acids 129-213), AG-K was nonetheless sufficient for binding to the AGL proteins. ag-agl9-1 3 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 As shown in Table 1, although AG-KC bound to AGL2, AGL4, AGL6 or AGL9 more strongly than AG-K(amino acids 129-213), AG-K was nonetheless sufficient for binding to the AGL proteins. ag-agl6-1 3 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 As shown in Table 1, although AG-KC bound to AGL2, AGL4, AGL6 or AGL9 more strongly than AG-K(amino acids 129-213), AG-K was nonetheless sufficient for binding to the AGL proteins. The sequence provided by the authors around the binding site of AGL6 is 'NNKKPEE' however the sequence around the binding site in the UniProt record is 'NNKPEE'. ag-agl2-1 3 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 As shown in Table 1, although AG-KC bound to AGL2, AGL4, AGL6 or AGL9 more strongly than AG-K(amino acids 129-213), AG-K was nonetheless sufficient for binding to the AGL proteins. ag-agl2-2 1 8 unspecified role unspecified role bait bait region Py tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4 In vitro binding of the AG and AGL K domains. ag-agl6-2 1 5 unspecified role unspecified role bait bait region Py tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 4 ag-agl9-2 1 6 unspecified role unspecified role bait bait region Py tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 4