MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The cyclophilin homolog NinaA functions as a chaperone, forming a stable complex in vivo with its protein target rhodopsin. The cyclophilin homolog NinaA functions as a chaperone, forming a stable complex in vivo with its protein target rhodopsin. EMBO J. (0261-4189) 1994 imex curation Baker EK., Colley NJ., Zuker CS. suggested by aceol Only protein-protein interactions drome-head Drosophila melanogaster head pull down pull down predetermined predetermined participant predetermined Baker EK., Colley NJ., Zuker CS. suggested by aceol EMBO J. (0261-4189) 1994 Only protein-protein interactions imex curation ops1_drome Opsin Rh1 ninaE Rh1 CG4550 Outer R1-R6 photoreceptor cells opsin Neither inactivation nor afterpotential E protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEAESKA DIP protein P06002 original sequence version: 108 FFF36C90DDD68294 cypr_drome Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme ninaA CG3966 Rotamase protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKSLLNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYPDDFNILGWIKAAGLPVTSSFCVLLIFHYFFRQLNMYC 1BF3CD01C31119B4 ninae-ninaa 1 Rhodopsin 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NinaA 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1 F2A mint