MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Intact intracellular tail is critical for proper functioning of the tumor-associated, hypoxia-regulated carbonic anhydrase IX. Intact intracellular tail is critical for proper functioning of the tumor-associated, hypoxia-regulated carbonic anhydrase IX. FEBS Lett. (0014-5793) 2009 imex curation Hulikova A., Zatovicova M., Svastova E., Ditte P., Brasseur R., Kettmann R., Supuran CT., Kopacek J., Pastorek J., Pastorekova S. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging monoclonal immunost monoclonal antibody immunostaining monoclonal immunost Hulikova A., Zatovicova M., Svastova E., Ditte P., Brasseur R., Kettmann R., Supuran CT., Kopacek J., Pastorek J., Pastorekova S. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation e2rai4_canlf Carbonic anhydrase CA9 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAPLCPSPWLPLLIPAPSLGPGVQLLLILPLLVPVHPQSLSRIQGTPGLGGDSSGEDDQLDEENLPSEEDPHGEEDPPGEEDPPGEEDPPGEEDPSGMKTEPGKEDSLKLEDLPTVEAPRDTPGSQNNAHRHNKGDDHSHWRYGGDPPWPQVSPACAGRFQSPVDIRPQLAALSPALPPLELLGFELPPLPELRLRNNGHTVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVDGHRFPAEIHVVHISTAFAKVEEALGRPGGLAVLAAFLQEGPEENSAYEQLLSHLEEITEEDSETWVPGLDVSALLPSDLSRYFRYEGSLTTPPCAQGVIWTVFNQTVRLSAKQLHTLSGSLWGPDDSRLQLNFRATQPLNGRIIEASFPAQVESSPRSFEPVHLNSCLGAGDILAVVFGLLFAVTSIAFIVQMRKQGRLRNGTKGNVSYHPAEVTETVA mint 012039B212E7B1C3 q95le0_canlf protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MGPRYGGAPALLLPLLLLLQVSSGLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGCTGLPRTAYVSDDTRFKVGTDGVITVKRPLQLHKPEISFLVHAWDSSRRKLSTRVRLKAATHHHHHHHDAPSKTQTEVLTFPSSQHGLRRQKRDWVIPPISCPENEKGPFP EA40F4775B59B0FD ca9-q95le0 1 CA IX 2 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell E-cadherin 3 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f1a mint