MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Radioprotection by short-term oxidative preconditioning: role of manganese superoxide dismutase. Radioprotection by short-term oxidative preconditioning: role of manganese superoxide dismutase. FEBS Lett. (0014-5793) 2009 Belikova NA., Glumac A., Rafikov R., Jiang J., Greenberger JS., Kagan VE., Bayir H. in vitro In vitro zymography zymography predetermined predetermined participant predetermined Belikova NA., Glumac A., Rafikov R., Jiang J., Greenberger JS., Kagan VE., Bayir H. FEBS Lett. (0014-5793) 2009 sodm_human Superoxide dismutase [Mn], mitochondrial SOD2 protein protein human Homo sapiens Human MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK CA047D7900AE5905 sod2-1 1 MnSOD 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component cell lysate cell lysate Stoichiometry: 4.0 physical association physical association f3c mint