MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A functional heteromeric MIF receptor formed by CD74 and CXCR4. A functional heteromeric MIF receptor formed by CD74 and CXCR4. FEBS Lett. (0014-5793) 2009 Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri FEBS Lett. (0014-5793) 2009 A functional heteromeric MIF receptor formed by CD74 and CXCR4. A functional heteromeric MIF receptor formed by CD74 and CXCR4. FEBS Lett. (0014-5793) 2009 Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri FEBS Lett. (0014-5793) 2009 A functional heteromeric MIF receptor formed by CD74 and CXCR4. A functional heteromeric MIF receptor formed by CD74 and CXCR4. FEBS Lett. (0014-5793) 2009 Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri human-mm6 Human-Mono Mac 6 monoblastic leukemic cell line mm6 Mono Mac 6 human monoblastic leukemic cell line cell line derived from PBLs of a patient with monoblastic leukemia. Contains an endogenous MLL-AF9 translocation. Contains an endogenous MLL-AF9 translocation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schwartz V., Lue H., Kraemer S., Korbiel J., Krohn R., Ohl K., Bucala R., Weber C., Bernhagen J. suggested by aryamontri FEBS Lett. (0014-5793) 2009 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM 27A13F252D5FB91D cd74-cxcr4 2 CD74 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CXCR4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F1D homomint mint cd74-cxcr4-1 1 CD74 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CXCR4 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A homomint mint cxcr4-cd74 1 CXCR4 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CD74 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B F2C homomint mint cd74-cxcr4-2 3 CXCR4 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD74 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C homomint mint