MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Oligomerization is required for the activity of recombinant soluble LOX-1. Oligomerization is required for the activity of recombinant soluble LOX-1. FEBS J. (1742-464X) 2009 Cao W., Calabro V., Root A., Yan G., Lam K., Olland S., Sanford J., Robak A., Zollner R., Lu Z., Ait-Zahra M., Agostinelli R., Tchistiakova L., Gill D., Harnish D., Paulsen J., Shih HH. suggested by aryamontri human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Cao W., Calabro V., Root A., Yan G., Lam K., Olland S., Sanford J., Robak A., Zollner R., Lu Z., Ait-Zahra M., Agostinelli R., Tchistiakova L., Gill D., Harnish D., Paulsen J., Shih HH. suggested by aryamontri FEBS J. (1742-464X) 2009 olr1_human Oxidized low-density lipoprotein receptor 1 OLR1 LOX1 Lectin-type oxidized LDL receptor 1 Lectin-like oxidized LDL receptor 1 CLEC8A C-type lectin domain family 8 member A protein protein human Homo sapiens Human MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ DIP protein P78380 original sequence version: 96 Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria mint Defects in OLR1 may be a cause of susceptibility to myocardial infarction [MIM:608557] Defects in OLR1 may be associated with susceptibility to Alzheimer disease (AD) [MIM:104300]. Involvement in AD is however unclear: according to some authors (Ref.10, Ref.13 and Ref.18), variations in OLR1 modify the risk of AD, while according to other (Ref.15 and Ref.16), they do not 852DE6595DC3D361 olr1-olr1 1 LOX1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7152056]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 274-274, sequence length 273 [EBI-7152056]61-274 fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LOX1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7152061]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 274-274, sequence length 273 [EBI-7152061]61-274 fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association homomint mint F1D SF2D