IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Genetic and spatial interactions between FT, TSF and SVP during the early stages of floral induction in Arabidopsis. Genetic and spatial interactions between FT, TSF and SVP during the early stages of floral induction in Arabidopsis. Plant J. (0960-7412) 2009 imex curation Jang S., Torti S., Coupland G. The authors do not provide cultivar information for the Rice proteins used in this study. Therefore the protein accession numbers identifying these proteins could not be unambiguously identified and since this was the case interactions involving these proteins were not curated. coupland@mpiz-koeln.mpg.de 27-Oct-2007: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jang S., Torti S., Coupland G. The authors do not provide cultivar information for the Rice proteins used in this study. Therefore the protein accession numbers identifying these proteins could not be unambiguously identified and since this was the case interactions involving these proteins were not curated. coupland@mpiz-koeln.mpg.de Accepted 2009-OCT-15 by ORCHARD. Plant J. (0960-7412) 2009 orchard Only protein-protein interactions imex curation fdp_arath bZIP transcription factor 27 FDP BZIP27 Protein FD PARALOG T17A5.15 At2g17770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLSSAKHNKINNHSAFSISSSSSSLSTSSSLGHNKSQVTMEEVWKEINLGSLHYHRQLNIGHEPMLKNQNPNNSIFQDFLNMPLNQPPPPPPPPSSSTIVTALYGSLPLPPPATVLSLNSGVGFEFLDTTENLLASNPRSFEESAKFGCLGKKRGQDSDDTRGDRRYKRMIKNRESAARSRARKQAYTNELELEIAHLQTENARLKIQQEQLKIAEATQNQVKKTLQRSSTAPF 43BEC502203963D5 ft_arath Protein FLOWERING LOCUS T FT At1g65480 F5I14.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL E4051B22CE66D508 tsf_arath Protein TWIN SISTER of FT At4g20370 TSF TFL1-like protein F9F13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLSRRDPLVVGSVVGDVLDPFTRLVSLKVTYGHREVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPPSGIHRIVLVLFRQLGRQTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQRENGCGGRRT 5BDEBC89A2D3BB43 fd_arath Protein FD bZIP transcription factor 14 FD BZIP14 T19K4.30 F4B14.170 At4g35900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLSSAKHQRNHRLSATNKNQTLTKVSSISSSSPSSSSSSSSTSSSSPLPSQDSQAQKRSLVTMEEVWNDINLASIHHLNRHSPHPQHNHEPRFRGQNHHNQNPNSIFQDFLKGSLNQEPAPTSQTTGSAPNGDSTTVTVLYSSPFPPPATVLSLNSGAGFEFLDNQDPLVTSNSNLHTHHHLSNAHAFNTSFEALVPSSSFGKKRGQDSNEGSGNRRHKRMIKNRESAARSRARKQAYTNELELEVAHLQAENARLKRQQDQLKMAAAIQQPKKNTLQRSSTAPF 9F50BE3364C89D54 ft-fd 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 4a An interaction between TSF and FD was clearly detected in these experiments, and growth of yeast cells was promoted as effectively by the interaction between TSF and FD as by FT and FD (Figure 4a). tsf-fd 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Figure 4a tsf-fdp 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Figure 4b FT and TSF interact with FDP. ft-fdp 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 4b Furthermore, an interaction between TSF and the FD-PARALOG protein (FDP) was also detected, as previously shown for FT (Figure 4b)