MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. EMBO J. (0261-4189) 2009 imex curation Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. EMBO J. (0261-4189) 2009 imex curation Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. EMBO J. (0261-4189) 2009 imex curation Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P84243 original sequence version: 72 DIP protein P84243 original sequence version: 73 DIP protein P84243 original sequence version: 97 DIP protein P84243 original sequence version: 125 DIP protein P84243 original sequence version: 110 DIP protein P84243 original sequence version: 96 5158ED279E6F9E1C php_drome Polyhomeotic-proximal chromatin protein CG18412 ph-p protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRRALKFMQKRADTESDTTTPVSTTASQGISASAILAGGTLPLKDNSNIREKPLHHNYNHNNNNSSQHSHSHQQQQQQQVGGKQLERPLKCLETLAQKAGITFDEKYDVASPPHPGIAQQQATSGTGPATGSGSVTPTSHRHGTPPTGRRQTHTPSTPNRPSAPSTPNTNCNSIARHTSLTLEKAQNPGQQVAATTTVPLQISPEQLQQFYASNPYAIQVKQEFPTHTTSGSGTELKHATNIMEVQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAATGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQMLTTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSMAAAAQQQQLTQQQQQFNQQQQQQLTQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSAVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNAGQAQQMQIPWFLQNAAGLQPFGPNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCNVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTPTTNPILAMTSMMNATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKEVPPPGEAKDPGAQ CF9B543DDBC79FBC h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 smbt_drome Polycomb protein Sfmbt Scm-like with four MBT domain-containing protein 1 CG16975 Sfmbt dSfmbt protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNPSELRMMWMSSQYNSERITLEDAATLLGHPTVGLSVMEDLSAHQPTLDMNPMMSLMGGDFTGQAAATAAALGVQPGTLIATNSNNLYGFAHMGGLQQQLLQQSAAAAVFQNYAEAMDNDVENGMVGMAMEAVVDDDDQVYGQRDNNFDDNGSELEPKQEIINIDDFVMMNEDNNSYDGTDFMTSSDKDISQSSSSCMAQMPGSLGVPGVEHDLLVPLPDGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCSASTSSALRSQRKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGMAVCKRCGAIGVKHTFYTKSRRFCSMACARGELYSLVLNTKMEGDQATTSSPDPGAGSESADLPGDQQQSQSDIELDLHAAHIKNANYRFRITDQSKITQLNSFGEPMSMGGDAAANNVQMAADETIAALNGGAVGDATAPGSTEEGASTPNSYLSAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIISIRRRMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRTIALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTNSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKVNPGRARSHKTNKSPFL 2BE2785144CA051F scm_drome Polycomb protein Scm Scm CG9495 Sex comb on midleg protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGGRDSSTSSGSNSAAPGASTNATSSASASASSTSTSASPGSTTSPASTQRQRGRPAKRATCTWCGEGKLPLQYVLPTQTGKKEFCSETCIAEFRKAYSKGACTQCDNVIRDGAPNKEFCSIMCMNKHQKKNCSTRHSGGSASGKGLAESERKLLASGAPAPTGPFQYESFHVFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHKSRMDSSSSKQRCPRPRYTVVAESEAMVPASPATAHFHPNCKGGPFINNSKLPCMVTGPTYQTLAKLCLQEVLAASTDTQQLSKLLFALEGDVHIVTAAGKNFTVKIPSPMRMKDDESLAQFIETLCTTCRACANLISLVHETEECKKCANSRKRQLTQSATPPSSPVLADKRNRQSNSATTSPSEKIIKQELAVKSPVESKSKTSTNNGKEPASQQNSNHSLNNNNNSASKSSNKVVIKSEPNGANAQTSSTTQALRKVRFQHHANTNTNSSATNGNQDTSQTTHVSTSHCSSSSTSSSTSLAGGSANTSTIGKYLAPLVAEVHPEQANVKPSNSYYKSPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAATAPAGAAATAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKLGPALKICNLVNKVNGRRNNLAL 7859FD0C7B91589E hist1h4a-sfmbt 2 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t1 f1a f2 hist1h4a-sfmbt-1 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 h3f3a-sfmbt 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp808Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:23:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:24:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp808ala' Tue Jun 30 15:39:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp808Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-1 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6,n6-dimethyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-2 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6,n6-dimethyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 st1 H3 protein\\'s taxid has not been specified hist1h4a-sfmbt-2 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp917Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:16:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:02:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp917ala' Tue Jun 30 18:16:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp917Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 sf1a st1 hist1h4a-sfmbt-3 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9VK33:p.Tyr948Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:18:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:44:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr948phe' Tue Jun 30 16:58:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr948Phe' Q9VK33:p.Glu947Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:55:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:58:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu947ala' Tue Jun 30 18:07:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu947Ala' direct interaction direct interaction t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-4 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9VK33:p.Asp697Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:18:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:44:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp697ala' Tue Jun 30 16:45:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp697Ala' direct interaction direct interaction t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-5 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9VK33:p.Tyr948Phe mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:56:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:34:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr948phe' Tue Jun 30 17:49:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr948Phe' Q9VK33:p.Asp917Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:19:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:23:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp917ala' Tue Jun 30 16:24:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp917Ala' Q9VK33:p.Glu947Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:51:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:12:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu947ala' Tue Jun 30 17:22:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu947Ala' direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-6 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp808Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:10:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:10:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp808ala' Tue Jun 30 18:49:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp808Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-7 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-8 3 HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-9 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HaK20me1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:33:24 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg19Ala binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint H4 protein\'s taxid has not been specified t2 h3f3a-sfmbt-3 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-4 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-5 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-6 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-7 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9VK33:p.Asp917Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:17:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:01:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp917ala' Tue Jun 30 16:36:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp917Ala' direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-8 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-9 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-10 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp697Ala mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:19:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:33:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp697ala' Tue Jun 30 19:23:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp697Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-11 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified trimethyllysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-12 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-13 3 H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-14 3 dSfmbt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H3 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dimethyllysine n6,n6-dimethyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain prerequisite-ptm direct interaction direct interaction homomint mint t2 st1 H3 protein\\'s taxid has not been specified scm-ph_p-1 1 Scm 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ph 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association mint f7a sf3 scm-sfmbt 1 dSfmbt 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Scm 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f7a sf3