IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. There is also data in Fig. 6 which could have been entered but I was not confident about picking out which lines were actually present on the gel, and the text gave little help so I've had to stop. Experiments performed in a strain lacking NAS6, NAS2, RPN14, and HSM3 toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. Quantitative MS analysis, using stable isotope labeling in culture (SILAC), allowed determination of the precise amount of each 19S proteasome regulatory particle. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Multiple proteasome-interacting proteins assist the assembly of the yeast 19S regulatory particle. Cell (0092-8674) 2009 imex curation Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp davet Only protein-protein interactions 30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Saeki Y., Toh-E A., Kudo T., Kawamura H., Tanaka K. toue-ak@igakuken.or.jp, tanaka-kj@igakuken.or.jp Accepted 2009-AUG-24 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 30 imex curation rpn12_yeast 26S proteasome regulatory subunit RPN12 RPN12 NIN1 Nuclear integrity protein 1 YFR052W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV D901AAD4D07ED3D1 D901AAD4D07ED3D1 rpn13_yeast 26S proteasome regulatory subunit RPN13 RPN13 DAQ1 Proteasome non-ATPase subunit 13 YLR421C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD 752E8A12DC3799D4 752E8A12DC3799D4 prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A 0EA42A599E2B2E2A prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C 8454BBC9D549EC5C rpn10_yeast 26S proteasome regulatory subunit RPN10 RPN10 MCB1 SUN1 YHR200W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSMEEEQQRQERLRQQQQQQDQPEQSEQPEQHQDK 8A05198B0CD7C0C3 8A05198B0CD7C0C3 rpn5_yeast 26S proteasome regulatory subunit RPN5 RPN5 NAS5 YDL147W D1572 Proteasome non-ATPase subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK E5DC7F8E6AE27736 E5DC7F8E6AE27736 rpn6_yeast 26S proteasome regulatory subunit RPN6 RPN6 NAS4 YDL097C D2381 Proteasome non-ATPase subunit 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY A8B1F7E6F73A4024 A8B1F7E6F73A4024 sem1_yeast 26S proteasome complex subunit SEM1 SEM1 DSH1 YDR363W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ B66B578ABB01E672 B66B578ABB01E672 rpn2_yeast 26S proteasome regulatory subunit RPN2 RPN2 SEN3 YIL075C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLTTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKDVNAPLPTPFKVDDNVDFPSA 881E78EBC6BD934F 881E78EBC6BD934F rpn1_yeast 26S proteasome regulatory subunit RPN1 RPN1 HRD2 NAS1 RPD1 Proteasome non-ATPase subunit 1 HMG-CoA reductase degradation protein 2 YHR027C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDESDKKQQTIDEQSQISPEKQTPNKKDKKKEEEEQLSEEDAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE B77954F4A998BA7C B77954F4A998BA7C prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 C215422033FCE830 psmd9_yeast Probable 26S proteasome regulatory subunit p27 NAS2 YIL007C Proteasome non-ATPase subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEEEELSKLLANVKIDPSLTSRISQIDSFKLSELMVLKTDIETQLEAYFSVLEQQGIGMDSALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDLNHLLQRSHVLLNQHFDNMNVKSNQDARRNNDDQAIQYTIPFAFISEVVPGSPSDKADIKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVLLLREGQILKTSLTPSRNWNGRGLLGCRIQEL 1BA966C5B7B2D02B 1BA966C5B7B2D02B prs4_yeast 26S proteasome regulatory subunit 4 homolog RPT2 YHS4 YTA5 YDL007W D2920 Tat-binding homolog 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL EB735354C3A0EBD4 EB735354C3A0EBD4 prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F 9C59E92A0794F60F ubp6_yeast Ubiquitin carboxyl-terminal hydrolase 6 UBP6 Ubiquitin-specific-processing protease 6 Deubiquitinating enzyme 6 Ubiquitin thioesterase 6 YFR010W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGETFEFNIRHSGKVYPITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIKIYPLIKPGSTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQLFHSMSIVFGDKFSEDFRIQFKTTIKDTANDNDITVKENESDSKLQCHISGTTNFMRNGLLEGLNEKIEKRSDLTGANSIYSVEKKISRLPKFLTVQYVRFFWKRSTNKKSKILRKVVFPFQLDVADMLTPEYAAEKVKVRDELRKVEKEKNEKEREIKRRKFDPSSSENVMTPREQYETQVALNESEKDQWLEEYKKHFPPNLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMYKGFGL DAE54D1F8AC9960C DAE54D1F8AC9960C hsm3_yeast DNA mismatch repair protein HSM3 YBR272C YBR1740 HSM3 Enhanced spontaneous mutability protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEKETNYVENLLTQLENELNEDNLPEDINTLLRKCSLNLVTVVSLPDMDVKPLLATIKRFLTSNVSYDSLNYDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGKNYSTGSETKIADCR 8B739BCC9A46A63E 8B739BCC9A46A63E rpn8_yeast 26S proteasome regulatory subunit RPN8 RPN8 O5360 YOR261C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN 6EE6009545A3D0EF 6EE6009545A3D0EF psd10_yeast Probable 26S proteasome regulatory subunit p28 NAS6 YGR232W G8564 Proteasome non-ATPase subunit 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 6B30C0DD034A6289 6B30C0DD034A6289 rpn9_yeast 26S proteasome regulatory subunit RPN9 RPN9 NAS7 YDR427W D9461.14 Proteasome non-ATPase subunit 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV 540F7DF8C23469A1 540F7DF8C23469A1 rpn7_yeast 26S proteasome regulatory subunit RPN7 RPN7 P8283.8 YPR108W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV B21B66CD818E636D B21B66CD818E636D rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D 9DDE8BD74890894D rpn3_yeast 26S proteasome regulatory subunit RPN3 RPN3 SUN2 YER021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTAVMMDVDSSGVNDLHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL B08B58663DDA85DC B08B58663DDA85DC prs6b_yeast 26S proteasome regulatory subunit 6B homolog RPT3 YNT1 YTA2 YDR394W D9509.14 Protein YNT1 Tat-binding homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK E12F0995A60732BD E12F0995A60732BD rpn14_yeast 26S proteasome regulatory subunit RPN14 YGL004C RPN14 Proteasome non-ATPase subunit 14 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKTITVAHIQYDFKAVLEENDENDDEFYINVDKNLNEIKEHKIVVLGNSRGVDAGKGNTFEKVGSHLYKARLDGHDFLFNTIIRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEFGTYGKYVIAGHVSGVITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGYENGMLAQWDLRSPECPVGEFLINEGTPINNVYFAAGALFVSSGFDTSIKLDIISDPESERPAIEFETPTFLVSNDDEVSQFCYVSDDESNGEVLEVGKNNFCALYNLSNP 025CAB9A872E1AB8 025CAB9A872E1AB8 nas6-rpn2-1 5 23 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 30 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Figs. 1G and 1H nas6-rpn2-2 5 20 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 23 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Figs. 1G and 1H nas6-rpt3-1 2 25 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association Nas6 specifically bound Rpt3 (Figure 2A). Figs. 2A, 2B The domain boundaries are not given in the article so have been inferred from the corresponding UniProtKB entry. rpn14-rpt6-1 2 21 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain 31 unspecified role unspecified role prey prey physical association physical association Furthermore, specific PIP-Rpt pairs were detected: Rpn14-Rpt6, Nas2-Rpt5, and Hsm3-Rpt1 (Figure 2A) Figs. 2A, 2B The domain boundaries are not given in the article so have been inferred from the corresponding UniProtKB entry. nas2-rpt5-2 2 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain physical association physical association Furthermore, specific PIP-Rpt pairs were detected: Rpn14-Rpt6, Nas2-Rpt5, and Hsm3-Rpt1 (Figure 2A) Figs. 2A, 2B The domain boundaries are not given in the article so have been inferred from the corresponding UniProtKB entry. hsm3-rpt1-1 2 11 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain 23 unspecified role unspecified role prey prey physical association physical association Furthermore, specific PIP-Rpt pairs were detected: Rpn14-Rpt6, Nas2-Rpt5, and Hsm3-Rpt1 (Figure 2A) Figs. 2A, 2B The domain boundaries are not given in the article so have been inferred from the corresponding UniProtKB entry. rpn1-rpn7-1 7 27 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization In the Rpn1-yEGFP1F Rpn7-mCherry expressing cells, both proteins were colocalized mainly in the nucleus (Figure 2C), Fig. 2C rpn1-rpn2-4 3 17 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey association association Fig. 4B A single band appear in the Rpt 2/3/4/5 identification region but the authors does not give an actual identification to this protein and it cannot be assigned from the image on the gel. rpn7-rpn2-2 3 27 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig. 4B rpn1-rpt2-1 1 20 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component physical association physical association whereas a slower migrating band contained both Rpn1 and Rpt2 (band II). Fig. 4C rpn1-rpt2-2 1 17 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 22 unspecified role unspecified role neutral component neutral component physical association physical association In addition, the faint slowest band contained Rpn1, Rpt2, and Ubp6 (band III). Fig. 4C rpn3-rpn5-1 1 8 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component 28 unspecified role unspecified role neutral component neutral component 27 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component association association Fig. 4C nas2-rpt4-1 1 10 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The major Nas2 complex was Nas2-Rpt4-Rpt5, which was also identified by native-PAGE-MS (Figure 6C). Fig. 6C nas6-rpn14-1 1 31 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Other 19S regulatory particles (RP) components were seen as present but not indentified. Fig. 6D rpn14-hsm3-1 1 25 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E Other components of the proteasome lid and 19S regularoty subunit were seen as being present but were not identified. rpn14-hsm3-2 1 23 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6F Other components of the proteasome lid and 19S regulatory subunit were seen as being present but were not identified. nas2-rpt4-2 6 18 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The major Nas2 complex was Nas2-Rpt4-Rpt5, which was also identified by native-PAGE-MS (Figure 6C). Fig. 6C hsm3-rpn1-3 1 11 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6F Other components of the proteasome lid and 19S regulatory subunit were seen as being present but were not identified. nas6-rpn2-3 6 20 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey physical association physical association Fig. 6D nas6-rpn3-1 6 25 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey physical association physical association Fig. 6D Because the SILAC Light/Heavy isotope ratios of all nine lid subunits were essentially of the same value, the authors simply note the lid in Fig. 6D as corresponding to the identities of the subunits. nas6-rpt3-2 6 30 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The remaining not, vert, similar10% of the total complex was Nas6-Rpt3-Rpt6 and a more heterogeneous complex. Fig. 6C rpn24-rpn2-1 6 30 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey physical association physical association Fig. 6E Interestingly, the Rpn14 complexes were divided into four distinct complexes by MS, Rpn14-Rpt3-Rpt6, Rpn14-Rpt3not, vert, similarRpt6-Rpn2-Rpn13, Rpn14-base, and Rpn14-RP (Figure 6E). rpn14-rpn3-1 6 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey physical association physical association Fig. 6E Because the SILAC Light/Heavy isotope ratios of all nine lid subunits were essentially of the same value, the authors simply note the lid in Fig. 6E as corresponding to the identities of the subunits. Interestingly, the Rpn14 complexes were divided into four distinct complexes by MS, Rpn14-Rpt3-Rpt6, Rpn14-Rpt3not, vert, similarRpt6-Rpn2-Rpn13, Rpn14-base, and Rpn14-RP (Figure 6E). rpn14-rpt3-1 6 21 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interestingly, the Rpn14 complexes were divided into four distinct complexes by MS, Rpn14-Rpt3-Rpt6, Rpn14-Rpt3not, vert, similarRpt6-Rpn2-Rpn13, Rpn14-base, and Rpn14-RP (Figure 6E). Fig. 6E rpn14-rpt3-2 6 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey physical association physical association Interestingly, the Rpn14 complexes were divided into four distinct complexes by MS, Rpn14-Rpt3-Rpt6, Rpn14-Rpt3not, vert, similarRpt6-Rpn2-Rpn13, Rpn14-base, and Rpn14-RP (Figure 6E). Fig. 6E hsm3-rpn3-1 6 8 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey physical association physical association Fig. 6F Because the SILAC Light/Heavy isotope ratios of all nine lid subunits were essentially of the same value, the authors simply note the lid in Fig. 6E as corresponding to the identities of the subunits. On the other hand, three distinct Hsm3 complexes were identified by both the native-PAGE-MS and quantitative MS: Hsm3-Rpt1-Rpt2-Rpn1, Hsm3-base, and Hsm3-RP (Figure 6F). hsm3-rpn2-1 6 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey physical association physical association Fig. 6F On the other hand, three distinct Hsm3 complexes were identified by both the native-PAGE-MS and quantitative MS: Hsm3-Rpt1-Rpt2-Rpn1, Hsm3-base, and Hsm3-RP (Figure 6F). hsm3-rpn1-4 6 20 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6F On the other hand, three distinct Hsm3 complexes were identified by both the native-PAGE-MS and quantitative MS: Hsm3-Rpt1-Rpt2-Rpn1, Hsm3-base, and Hsm3-RP (Figure 6F). rpn7-rpn2-3 4 21 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait region egfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey association association Fig. 4B Identification of RPT2, RPT3, RPT4 and RPT5 depend on the authors text as do not clearly separate into distinct bands on the gel image in the text. The participant EBI-31337(O94742) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. rpn1-rpn2-5 4 17 unspecified role unspecified role bait bait region egfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Fig. 4B Identification of RPT2, RPT3, RPT4 and RPT5 depend on the authors text as do not clearly separate into distinct bands on the gel image in the text. The participant EBI-31337(O94742) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later.