MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. EMBO Rep. (1469-221X) 2009 imex curation Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. EMBO Rep. (1469-221X) 2009 imex curation Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. G-protein signalling negatively regulates the stability of aryl hydrocarbon receptor. EMBO Rep. (1469-221X) 2009 imex curation Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nakata A., Urano D., Fujii-Kuriyama Y., Mizuno N., Tago K., Itoh H. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation gna13_mouse Guanine nucleotide-binding protein subunit alpha-13 Gna-13 Gna13 protein protein mouse Mus musculus Mouse MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ DIP protein P27601 original sequence version: 80 45A6A6DB47C707BB aip_mouse AH receptor-interacting protein Aip Aryl-hydrocarbon receptor-interacting protein protein protein mouse Mus musculus Mouse MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGKPMELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH mint May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting 25C61AB65F9064F2 gnaq_mouse Guanine nucleotide-binding protein G(q) subunit alpha Guanine nucleotide-binding protein alpha-q Gnaq protein protein mouse Mus musculus Mouse MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P21279 original sequence version: 157 DIP protein P21279 original sequence version: 127 DIP protein P21279 original sequence version: 141 DIP protein P21279 original sequence version: 170 3BCBA4EE7DADADBF gna13-aip 2 Aip 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G alpha 13 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A homomint mint aip-gna13 3 Aip 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G alpha 13 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction homomint mint F1B F1D aip-gna13-1 3 Aip 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G alpha 13 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction homomint mint F1B F1D aip-gnaq 3 Aip 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G alpha q 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F1C homomint mint gnaq-aip 1 Aip 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AhR 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F1D homomint mint