MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22. Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22. FEBS Lett. (0014-5793) 2009 de Moura PR., Watanabe L., Bleicher L., Colau D., Dumoutier L., Lemaire MM., Renauld JC., Polikarpov I. suggested by aryamontri in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined de Moura PR., Watanabe L., Bleicher L., Colau D., Dumoutier L., Lemaire MM., Renauld JC., Polikarpov I. suggested by aryamontri FEBS Lett. (0014-5793) 2009 i22r2_human Interleukin-22 receptor subunit alpha-2 IL22RA2 Interleukin-22-binding protein UNQ5793/PRO19598/PRO19822 Cytokine receptor family 2 member 10 Cytokine receptor class-II member 10 Cytokine receptor family type 2, soluble 1 ZcytoR16 protein protein human Homo sapiens Human MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses. Isoform 1 may play a role in establishing and maintaining successful pregnancy mint C96ECEC5D78AC79B il22_human Interleukin-22 IL22 ILTIF UNQ3099/PRO10096 ZCYTO18 IL-10-related T-cell-derived-inducible factor Cytokine Zcyto18 protein protein human Homo sapiens Human MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI DIP protein Q9GZX6 original sequence version: 74 DIP protein Q9GZX6 original sequence version: 95 Cytokine that contributes to the inflammatory response in vivo mint 3C35E64D60CF8767 il22-il22ra2 1 IL-22 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified IL-22 BP 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F1 homomint mint