MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. Mol. Endocrinol. (0888-8809) 2009 mimix curation Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Mol. Endocrinol. (0888-8809) 2009 partial coverage mimix curation mimix curation PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. Mol. Endocrinol. (0888-8809) 2009 mimix curation Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Mol. Endocrinol. (0888-8809) 2009 partial coverage mimix curation mimix curation PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. PLC-gamma1 and Rac1 coregulate EGF-induced cytoskeleton remodeling and cell migration. Mol. Endocrinol. (0888-8809) 2009 mimix curation Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li S., Wang Q., Wang Y., Chen X., Wang Z. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Mol. Endocrinol. (0888-8809) 2009 partial coverage mimix curation mimix curation plcg1_human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 PLC-148 PLC1 Phospholipase C-II PLCG1 Phosphoinositide phospholipase C-gamma-1 Phospholipase C-gamma-1 protein protein human Homo sapiens Human MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL DIP protein P19174 original sequence version: 144 DIP protein P19174 original sequence version: 152 DIP protein P19174 original sequence version: 181 DIP protein P19174 original sequence version: 169 AE05ABE2A18EDDAC rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR DIP protein Q13177 original sequence version: 166 DIP protein Q13177 original sequence version: 114 00A7CD15F93D4180 rac1-plcg1 2 PLCGamma1 4 unspecified role unspecified role prey prey RAC1 5 unspecified role unspecified role bait bait physical association physical association f1a f1b homomint mint we have inferrede proteins accession number to homo, but the interaction has been detected in Cos 7 cells. rac1-plcg1-1 2 RAC1 5 unspecified role unspecified role bait bait PLCGamma1 4 unspecified role unspecified role prey prey yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f2b homomint mint we have inferred Rac1 accession number to homo but it has been found in Cos 7 cells. Plc gamma 1 taxid has not been specified. plcg1-rac1 3 RAC1 5 unspecified role unspecified role prey prey P63000:p.Pro109Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:47:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro109ala' Tue Jun 30 19:11:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro109Ala' gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P63000:p.Pro106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:57:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:05:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro106ala' Tue Jun 30 16:23:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro106Ala' PLCGamma1 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c homomint mint proteins\' taxid has not been specified. plcg1-rac1-1 3 RAC1 5 unspecified role unspecified role prey prey PLCGamma1 4 unspecified role unspecified role bait bait P19174:p.Pro842Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P L Tue Jul 12 10:57:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:06:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro842leu' Tue Jun 30 18:52:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro842Leu' gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4a homomint mint proteins\' taxid has not been specified. plcg1-rac1-2 3 RAC1 5 unspecified role unspecified role prey prey PLCGamma1 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint we have inferred Rac1 accession number to homo but it has been found in Cos 7 cells. Plc gamma 1 taxid has not been specified. f2a f8a f8b pak2-rac1-2 3 RAC1 5 unspecified role unspecified role prey prey PAK 6 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint proteins\' taxid has not been specified f5 f6a f6b plcg1-rac1-3 1 PLCGamma1 4 unspecified role unspecified role bait bait P19174:p.Pro842Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P L Tue Jul 12 10:17:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:41:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro842leu' Tue Jun 30 18:44:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro842Leu' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAC1 5 unspecified role unspecified role prey prey physical association physical association f4b homomint mint we have inferred Rac1 accession number to homo but it has been found in Cos 7 cells. Plc gamma 1 taxid has not been specified. rac1-plcg1-2 1 PLCGamma1 4 unspecified role unspecified role prey prey RAC1 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63000:p.Pro109Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:56:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:45:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro109ala' Tue Jun 30 20:22:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro109Ala' P63000:p.Pro106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:18:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:14:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro106ala' Tue Jun 30 17:58:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro106Ala' physical association physical association homomint mint f3a f3b proteins\' taxid has not been specified.