IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. Plant J. (0960-7412) 2009 imex curation Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk 09-April-2009: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk Accepted 2009-APR-23 by JYOTI. 09-April-2009: Contacted by JYOTI. Plant J. (0960-7412) 2009 jyoti Only protein-protein interactions imex curation A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. Plant J. (0960-7412) 2009 imex curation Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk 09-April-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk Accepted 2009-APR-23 by JYOTI. 09-April-2009: Contacted by JYOTI. Plant J. (0960-7412) 2009 jyoti Only protein-protein interactions imex curation mip1_arath MND1-interacting protein 1 At1g32530 MIP1 F5D14.31 T9G5.5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVENLVYHPGLTDSGSVNLNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHCYGELDVLTNIVNNSLSYLNSGGGGGGSNGNGEDRTETGFTDLRDLEEYSLAGMIYLLQQVKPNLSKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAGFMAPALCRFHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRNVAAFAAGYRASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEESVSTVLEKFRDLNLDDNLESVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVSEELAELKTLSSEREGIQLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLENQNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIELDFQRHKDDHQRLEQELGRLKASSDSDSSHISNNAWKPKKSQGENIAKLLEEIDKLEGSYDNEANYDRECIICMKDEVSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGLVQQRIRIFGATS DIP protein Q8RX22 original sequence version: 86 1DDF44ADFBCC975F xri1_arath Protein XRI1 XRI1 Protein X-RAY INDUCED 1 K24G6.5 At5g48720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDYGDDDRSSSWNWQVDNYNHQPQSHFSDVPDCTMTEVTLNQEDHSYMFDDENTPVKACSELGYHVTTEDTNRKMEVHSETRSALKRRRMLQFEDQPETSLFSSESFSAILKSSARDDTFDELLPEGSQLIEGFSEDASASSFEGLDLYAEEWYADCLNDAETPMLPDDLNFGSPDVQVDISEYLNVPPETETREVQRPVTRSSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG 23B32F668BDB6FEA mnd1_arath Meiotic nuclear division protein 1 homolog MND1 Meiotic nuclear division 1-like protein F19B15.200 At4g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA 131BB5146D8C91ED hop2_arath Homologous-pairing protein 2 homolog HOP2 T6J4.9 At1g13330 AHP2 Protein HOP2 Protein ARABIDOPSIS HOMOLOG PAIRING 2 Protein AHP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPKSDNTEAIVLNFVNEQNKPLNTQNAADALQKFNLKKTAVQKALDSLADAGKITFKEYGKQKIYIARQDQFEIPNSEELAQMKEDNAKLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLREGITLVRPEDKKAVEDMYADKINQWRKRKRMFRDIWDTVTENSPKDVKELKEELGIEYDEDVGLSFQAYADLIQHGKKRPRGQ 4F8FB9166ABF294B mip1-mnd1 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 8a interaction screen identified a MIP1 fragment towards the C-terminal region (498-589) as sufficient for AtMND1 binding. mip1-2 1 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait physical association physical association Figure 8a mip1-ahp2 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 8a The AtMND1 interaction screen identified a MIP1 fragment towards the C-terminal region (498-589) as sufficient for AtMND1 binding. This region of MIP also interacted with AHP2 (the Arabidopsis HOP2 homologue) mip1-xri1 1 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association Figure 8b Further analysis of XRI1 identified the C-terminal 26 amino acids as sufficient for MIP1 interaction in yeast two-hybrid analysis (Figure 8b). Two UniProt proteins map to the TAIR locus At5g48720 ,Q6NLW5IS 226 amino acids in length and corresponds to the protein described by the authors and TAIR record whereas Q9FKC4 is 286 amino acids. In this case the shorter version of the UniProt protein mapping to the TAIR locus cited in the paper was annotated. mip1-mnd1-1 2 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 8c Figure 8d Similarly, full-length MIP1 and its C-terminal region bound to MND1- or XRI1-coated beads, but not to controls mip1-xri1-1 2 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 8c Figure 8d Similarly, full-length MIP1 and its C-terminal region bound to MND1- or XRI1-coated beads, but not to controls (Figure 8d). Two UniProt proteins map to the TAIR locus At5g48720 ,Q6NLW5IS 226 amino acids in length and corresponds to the protein described by the authors and TAIR record whereas Q9FKC4 is 286 amino acids. In this case the shorter version of the UniProt protein mapping to the TAIR locus cited in the paper was annotated.