IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Array MAPPIT: high-throughput interactome analysis in mammalian cells. Array MAPPIT: high-throughput interactome analysis in mammalian cells. Nat. Cell Biol. (1465-7392) 2009 imex curation Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be Accepted 2009-NOV-8 by DAVET. 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) Nat. Cell Biol. (1465-7392) 2009 davet Only protein-protein interactions imex curation Array MAPPIT: high-throughput interactome analysis in mammalian cells. Array MAPPIT: high-throughput interactome analysis in mammalian cells. Nat. Cell Biol. (1465-7392) 2009 imex curation Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be Accepted 2009-NOV-8 by DAVET. 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) Nat. Cell Biol. (1465-7392) 2009 2009 davet Only protein-protein interactions imex curation Array MAPPIT: high-throughput interactome analysis in mammalian cells. Array MAPPIT: high-throughput interactome analysis in mammalian cells. Nat. Cell Biol. (1465-7392) 2009 imex curation Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be Accepted 2009-NOV-8 by DAVET. 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) Nat. Cell Biol. (1465-7392) 2009 davet Only protein-protein interactions imex curation Array MAPPIT: high-throughput interactome analysis in mammalian cells. Array MAPPIT: high-throughput interactome analysis in mammalian cells. Nat. Cell Biol. (1465-7392) 2009 imex curation Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be Accepted 2009-NOV-8 by DAVET. 23-Feb-2010: Contacted by JYOTI. HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) Nat. Cell Biol. (1465-7392) 2009 davet Only protein-protein interactions imex curation spsb4_human SPRY domain-containing SOCS box protein 4 SPSB4 SSB4 protein protein human Homo sapiens Human MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ 234A651A08217489 fbxw5_human F-box/WD repeat-containing protein 5 F-box and WD-40 domain-containing protein 5 FBXW5 FBW5 PP3971 protein protein human Homo sapiens Human MDEGGTPLLPDSLVYQIFLSLGPADVLAAGLVCRQWQAVSRDEFLWREQFYRYYQVARDVPRHPAAMSWYEEFQRLYDTVPCVEVQTLREHTDQVLHLSFSHSGYQFASCSKDCTVKIWSNDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEIAVISLDSFALLSRVRNKPYDVFGCWLTETSLISGNLHRIGDITSCSVLWLNNAFQDVESENVNVVKRLFKIQNLNASTVRTVMVADCSRFDSPDLLLEAGDPATSPCRIFDLGSDNEEVVAGPAPAHAKEGLRHFLDRVLEGRAQPQLSERMLETKVAELLAQGHTKPPERSATGAKSKYLIFTTGCLTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDIHGHIIGMGLSPDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQELLLTASDDATIKAWRSPRTMRVLQAPRPRPRTFFSWLASQRR DIP protein Q969U6 original sequence version: 115 DIP protein Q969U6 original sequence version: 79 7D389AB6F50193B1 fbxl8_human F-box/LRR-repeat protein 8 FBXL8 FBL8 F-box and leucine-rich repeat protein 8 F-box protein FBL8 protein protein human Homo sapiens Human MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA 7B91444E31E95931 eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC DIP protein P83940 original sequence version: 92 98D88696E883538B fbw1b_human F-box/WD repeat-containing protein 11 KIAA0696 FBXW11 BTRCP2 FBW1B FBXW1B F-box/WD repeat-containing protein 1B F-box and WD repeats protein beta-TrCP2 Homologous to Slimb protein protein protein human Homo sapiens Human MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR DIP protein Q9UKB1 original sequence version: 138 DIP protein Q9UKB1 original sequence version: 149 DIP protein Q9UKB1 original sequence version: 101 DIP protein Q9UKB1 original sequence version: 121 7CD40087EFAA5C8A rb40b_mouse Ras-related protein Rab-40B Rab40b SOCS box-containing protein RAR protein protein mouse Mus musculus Mouse MSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVVLVYDIANRWSFDGINRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQELCCRAVVSCTPGHLVDKLPLPVALRSHLKSFSMASGLNTRMMHGRSYSLTANSSHKRNSFRKVRTIRPPQSPPRNCARNSCKIS 73575AA0367BC3ED fbxl6_human F-box/LRR-repeat protein 6 FBXL6 FBL6 F-box and leucine-rich repeat protein 6 F-box protein FBL6 FBL6A protein protein human Homo sapiens Human MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS 8153185444653BB2 asb9_human Ankyrin repeat and SOCS box protein 9 ASB9 protein protein human Homo sapiens Human MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL A1784DCFC294D85A spsb2_human SPRY domain-containing SOCS box protein 2 SPSB2 GRCC9 SSB2 Gene-rich cluster protein C9 protein protein human Homo sapiens Human MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ 0729EDDD0B598665 fbx44_human F-box only protein 44 FBXO44 FBG3 FBX30 FBX44 FBX6A FBXO6A F-box/G-domain protein 3 F-box protein FBX30 protein protein human Homo sapiens Human MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP 3DA167B70E22A7E8 skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK C794D62AFB75528A fbxw9_human F-box/WD repeat-containing protein 9 FBXW9 FBW9 F-box and WD-40 domain-containing protein 9 protein protein human Homo sapiens Human MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTWRLRALRRVRAPYPVVEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLIKTLGTKRNSTHEGWVWSLAAQDHRVCSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQLDSYLLCMSYQEPQLWAGDNQGLLHVFANRNGCFQLIRSFDVGHSFPITGIQYSVGALYTTSTDKTIRVHVPTDPPRTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA A2A5B378211A3D06 fbxl2_human F-box/LRR-repeat protein 2 F-box and leucine-rich repeat protein 2 F-box protein FBL2/FBL3 FBXL2 FBL2 FBL3 protein protein human Homo sapiens Human MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL 61938E434618BA3D fbw1a_human F-box/WD repeat-containing protein 1A BTRC BTRCP FBW1A FBXW1A F-box and WD repeats protein beta-TrCP E3RSIkappaB pIkappaBalpha-E3 receptor subunit Epididymis tissue protein Li 2a protein protein human Homo sapiens Human MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR DIP protein Q9Y297 original sequence version: 142 DIP protein Q9Y297 original sequence version: 153 DIP protein Q9Y297 original sequence version: 144 DIP protein Q9Y297 original sequence version: 145 DIP protein Q9Y297 original sequence version: 106 DIP protein Q9Y297 original sequence version: 82 DIP protein Q9Y297 original sequence version: 111 DIP protein Q9Y297 original sequence version: 125 4C67F3B7E400FD37 socs2_human Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 STAT-induced STAT inhibitor 2 CIS2 SSI2 STATI2 SOCS2 protein protein human Homo sapiens Human MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV DIP protein O14508 original sequence version: 133 DIP protein O14508 original sequence version: 61 DAFC4AD97F8182BF eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 98D88696E883538B fbx46_human F-box only protein 46 FBXO46 FBX46 FBXO34L F-box only protein 34-like protein protein human Homo sapiens Human MDRGSLLPFQLWCPRPFGTYSQNQPRPPSAALKPSACPEPGGGAEPDHGPAHSENTPPALATEVPASQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKVKGHWGSDSSKAKRRRRCLDPTKAPPDPGGREGPPAAEEGPASAGEDVDLLSVAEMVALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPDSGLPSGGGGRPGCAYPGSPGPGARAKDKITCDLYQLISPSRDALPSNVEFLLARADEASEGDSPAPARPEDTPPAPPPPPARDCGASGFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPPEPPPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLVKIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDVSLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEGR DIP protein Q6PJ61 original sequence version: 44 1DF8A0985D698D2E asb1_human Ankyrin repeat and SOCS box protein 1 ASB1 KIAA1146 protein protein human Homo sapiens Human MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRLLLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLLCLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE 0843C96AD1AF60D9 cdca3_human Cell division cycle-associated protein 3 CDCA3 Trigger of mitotic entry protein 1 Gene-rich cluster protein C8 C8 GRCC8 TOME1 protein protein human Homo sapiens Human MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES 48933FA7FF57112C skp1-fbxl8 2 7 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbxl15 2 7 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbxw5 2 6 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbx044 2 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbx02 2 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-cdca3 2 23 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbxl6 2 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbxw9 2 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table 1 For 33 clones, the sequence of which corresponded to 6 distinct proteins, the prey was a known interactor of SKP1. These include CDCA3, an F-box like protein that participates in E3 ligase complexes involved in cell cycle regulation, and a number of F-box proteins (FBXL8, FBXL15, FBXW5, FBXO44 and FBXO2), all of which are SCF E3 ligase subunits implicated in recognition of substrates targeted for ubiquitination. skp1-fbxw9-1 1 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 4a When a threshold of 10-fold ligand-induced reporter gene induction was used, the same set of 5 preys was positive in both experiments. All of these preys correspond to F-box proteins. Three (BTRC, FBXL8 and FBXW11) are known and 2 (FBXW9 and FBXO46) are novel SKP1 binding partners. skp1-fbx46 1 15 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association 4a When a threshold of 10-fold ligand-induced reporter gene induction was used, the same set of 5 preys was positive in both experiments. All of these preys correspond to F-box proteins. Three (BTRC, FBXL8 and FBXW11) are known and 2 (FBXW9 and FBXO46) are novel SKP1 binding partners. skp1-btrc 1 15 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 4a When a threshold of 10-fold ligand-induced reporter gene induction was used, the same set of 5 preys was positive in both experiments. All of these preys correspond to F-box proteins. Three (BTRC, FBXL8 and FBXW11) are known and 2 (FBXW9 and FBXO46) are novel SKP1 binding partners. skp1-fbxl8-1 1 7 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 4a When a threshold of 10-fold ligand-induced reporter gene induction was used, the same set of 5 preys was positive in both experiments. All of these preys correspond to F-box proteins. Three (BTRC, FBXL8 and FBXW11) are known and 2 (FBXW9 and FBXO46) are novel SKP1 binding partners. skp1-fbxw11 1 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 4a When a threshold of 10-fold ligand-induced reporter gene induction was used, the same set of 5 preys was positive in both experiments. All of these preys correspond to F-box proteins. Three (BTRC, FBXL8 and FBXW11) are known and 2 (FBXW9 and FBXO46) are novel SKP1 binding partners. eloc-socs2 1 19 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4b Five preys scored positive when the threshold was set at 10-fold induction. Four of these (SOCS2, RAB40B, ASB9 and ASB1) correspond to proteins known to bind to Elongin C. eloc-rab40b 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4b Five preys scored positive when the threshold was set at 10-fold induction. Four of these (SOCS2, RAB40B, ASB9 and ASB1) correspond to proteins known to bind to Elongin C. eloc-asb9 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4b Five preys scored positive when the threshold was set at 10-fold induction. Four of these (SOCS2, RAB40B, ASB9 and ASB1) correspond to proteins known to bind to Elongin C. eloc-asb1 1 22 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4b Five preys scored positive when the threshold was set at 10-fold induction. Four of these (SOCS2, RAB40B, ASB9 and ASB1) correspond to proteins known to bind to Elongin C. skp1-fbxw11-1 4 15 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 skp1-fbxw9-2 4 15 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 skp1-fbx046 4 15 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 eloc-socs2-1 3 20 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 eloc-spsb2 3 20 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 eloc-spsb4 3 20 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5