IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. Biochem. Biophys. Res. Commun. (0006-291X) 2009 imex curation Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr 09-April-2009: Contacted by JYOTI. Arabidopsis cDNA 3 day old etiolated seedling. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr Accepted 2009-APR-11 by ORCHARD. 09-April-2009: Contacted by JYOTI. Arabidopsis cDNA 3 day old etiolated seedling. Biochem. Biophys. Res. Commun. (0006-291X) 2009 orchard Only protein-protein interactions imex curation Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. Biochem. Biophys. Res. Commun. (0006-291X) 2009 imex curation Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr 09-April-2009: Contacted by JYOTI. Arabidopsis cDNA 3 day old etiolated seedling. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr Accepted 2009-APR-11 by ORCHARD. 09-April-2009: Contacted by JYOTI. Arabidopsis cDNA 3 day old etiolated seedling. Biochem. Biophys. Res. Commun. (0006-291X) 2009 orchard Only protein-protein interactions imex curation gstfa_arath Glutathione S-transferase F10 GSTF4 AtGSTF4 F7F1.8 At2g30870 GSTF10 ERD13 GST class-phi member 10 Protein EARLY RESPONSE TO DEHYDRATION 13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV 9A53C0AD19580C79 bak1_arath BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 BAK1 SERK3 At4g33430 F17M5.190 Somatic embryogenesis receptor-like kinase 3 ELG Somatic embryogenesis receptor kinase 3 Protein ELONGATED protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERRLMIPCFFWLILVLDLVLRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLTPLPASPPPPISPTPPSPAGSNRITGAIAGGVAAGAALLFAVPAIALAWWRRKKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNYPTHHPAVSGWIIGDSTSQIENEYPSGPR DIP protein Q94F62 original sequence version: 119 DIP protein Q94F62 original sequence version: 129 DIP protein Q94F62 original sequence version: 94 DIP protein Q94F62 original sequence version: 100 DIP protein Q94F62 original sequence version: 139 DIP protein Q94F62 original sequence version: 121 DIP protein Q94F62 original sequence version: 141 DIP protein Q94F62 original sequence version: 113 547B3F38FB46E1DD bak1-gstf10 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range physical association physical association Figure 1 AtGSTF10 was identified as a BAK1 interactor. The authors state that the GST sequence showed a specific interaction with BAK1 kinase domain and displayed no interaction with several non-relevant baits". The co-ordinates are not provided in the text therefore the co-ordinates were taken from the UniProt record for this protein and annotated as fuzzy co-ordinates to indicate the exact co-ordinates are unknown. bak1-gstf10-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1e Compared to the interaction of full-length GST and BAK1, we found that only GST(1�59), containing the N-terminal region prior to the start of the G-site, showed a specific interaction with similar strength to intact GST.