MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. Brain Res. (0006-8993) 2009 mimix curation Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Brain Res. (0006-8993) 2009 partial coverage mimix curation mimix curation The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. Brain Res. (0006-8993) 2009 mimix curation Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Brain Res. (0006-8993) 2009 partial coverage mimix curation mimix curation The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. Brain Res. (0006-8993) 2009 mimix curation Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Brain Res. (0006-8993) 2009 partial coverage mimix curation mimix curation The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. The postsynaptic density protein, IQ-ArfGEF/BRAG1, can interact with IRSp53 through its proline-rich sequence. Brain Res. (0006-8993) 2009 mimix curation Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanda M., Kamata A., Katsumata O., Fukunaga K., Watanabe M., Kondo H., Sakagami H. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Brain Res. (0006-8993) 2009 partial coverage mimix curation mimix curation a4gz26_mouse Iqsec2 IQArfGEF protein protein mouse Mus musculus Mouse MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRDLREESQLHRGELHRDPLGARDSPGRESQYQNLRETQFHHRELRESQFHQASRDVGYPNRDGAYQNREAIYRDKEREASYQLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHPGREKEAGYSAAVGVGQRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGENSRTVSVEGDAPGSDLSTAVDSPGSQPPYRLSQLPPTSSHMGGPPAGVGLPWAQRARLQPASVALRKQEEEEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDPVPPPSPERLPSTEPPPQGRPEFWAPAPLPPVPPPMPPGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLCKQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPNASQPGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDAGKRGRRNSVGSLDSTIEGSVISSPRPHQRMPPPPPPPPPEEYKSQRPVSNSSSFLGSLFGSKRGKGPFQMPPPPTGQASASSSSASSTHHHHHHHHHGHSHGGLGVLPDGQSKLQALHAQYCQGPGPAPPPYLPPQQPPLPPPPQQPPPLPQLGSIPPPPASAPPVGPHRHFHAHGPVPGPQHYTLGRPGRAPRRGAGGHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPAHKQGPKHFIFSHHPQMMPAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPLPPPSPHTPHSPLPPTSPHGPLHASGPPGTANPPSANPKAKPSRISTVV mint 2D43B4C065483CCB baip2_mouse Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor tyrosine kinase 53 kDa substrate Insulin receptor substrate protein of 53 kDa Baiap2 protein protein mouse Mus musculus Mouse MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTFAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEETLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPDRAVQLMQQMANSNGSILPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENVPVMNGVAGPDSEDYNPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLALPPPDYGTSSRAFPTQTAGTFKQRPYSVAVPAFSQGLDDYGARSVSRNPFANVHLKPTVTNDRSAPLLS DIP protein Q8BKX1 original sequence version: 69 45B4C660FBB07F72 iqsec2-baiap2 4 iq-arfgef/brag1 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain irsp53 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f1a homomint mint iqsec2-baiap2-1 4 iq-arfgef/brag1 5 unspecified role unspecified role bait bait A4GZ26:p.Pro1433Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P T Tue Jul 12 10:56:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:35:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1433thr' Tue Jun 30 20:24:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1433Thr' A4GZ26:p.Pro1434Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P T Tue Jul 12 10:56:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:38:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1434thr' Tue Jun 30 19:59:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1434Thr' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain irsp53 6 unspecified role unspecified role prey prey physical association physical association f3b homomint mint iqsec2-baiap2-2 3 iq-arfgef/brag1 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined irsp53 6 unspecified role unspecified role prey prey myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b homomint mint iqsec2-baiap2-3 3 iq-arfgef/brag1 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined irsp53 6 unspecified role unspecified role prey prey gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f2b homomint mint iqsec2-baiap2-4 3 iq-arfgef/brag1 5 unspecified role unspecified role bait bait A4GZ26:p.Pro1433Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P T Tue Jul 12 10:17:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:39:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1433thr' Tue Jun 30 17:30:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1433Thr' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain A4GZ26:p.Pro1434Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P T Tue Jul 12 10:17:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:22:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1434thr' Tue Jun 30 15:43:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1434Thr' gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined irsp53 6 unspecified role unspecified role prey prey gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3b homomint mint iqsec2-baiap2-5 2 iq-arfgef/brag1 5 unspecified role unspecified role bait bait flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined irsp53 6 unspecified role unspecified role prey prey myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1c homomint mint iqsec2-baiap2-6 1 iq-arfgef/brag1 5 unspecified role unspecified role bait bait irsp53 6 unspecified role unspecified role prey prey physical association physical association f1d homomint mint