MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters. A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters. EMBO J. (0261-4189) 2009 imex curation Bruck N., Vitoux D., Ferry C., Duong V., Bauer A., de Thé H., Rochette-Egly C. 2009-03-06 Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Bruck N., Vitoux D., Ferry C., Duong V., Bauer A., de Thé H., Rochette-Egly C. EMBO J. (0261-4189) 2009 2009-03-06 Only protein-protein interactions imex curation A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters. A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters. EMBO J. (0261-4189) 2009 imex curation Bruck N., Vitoux D., Ferry C., Duong V., Bauer A., de Thé H., Rochette-Egly C. 2009-03-06 Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bruck N., Vitoux D., Ferry C., Duong V., Bauer A., de Thé H., Rochette-Egly C. EMBO J. (0261-4189) 2009 2009-03-06 Only protein-protein interactions imex curation ddr1_mouse Epithelial discoidin domain-containing receptor 1 Ddr1 Cak Eddr1 Mpk6 Tyrosine kinase DDR Discoidin receptor tyrosine kinase Tyrosine-protein kinase CAK Cell adhesion kinase Protein-tyrosine kinase MPK-6 CD167 antigen-like family member A protein protein mouse Mus musculus Mouse MGTGTLSSLLLLLLLVTIGDADMKGHFDPAKCRYALGMQDRTIPDSDISVSSSWSDSTAARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVNDSSDTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGTPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQACSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLADDALNTV May be involved in cell-cell interactions and recognition mint DBB7FE03DDD79510 ks6a5_mouse Ribosomal protein S6 kinase alpha-5 Rps6ka5 Msk1 Nuclear mitogen- and stress-activated protein kinase 1 90 kDa ribosomal protein S6 kinase 5 RSK-like protein kinase protein protein mouse Mus musculus Mouse MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSTVAKDLLQRLLMKDPKKRLGCGPRDAEEIKEHLFFEKIKWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQVAASAQPPGQVVLCSLLLLALLFNRSLTRKPVTWTWLVHSTSQLPPLPPPMPEIVLFILLSDNGQLHTFLVMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKVIDFGFARLKPPDNQPLKTPCFTLHYAAPELLTHNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKRTSTSTETRSSSSESSRSSSSQSHGKTTPTKTLQPSNPTEGSNPDTLFQFSD mint Serine/threonine kinase required for the mitogen or stress-induced phosphorylation of the transcription factors CREB (cAMP response element-binding protein) and ATF1 (activating transcription factor-1). Essential role in the control of RELA transcriptional activity in response to TNF. Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and epidemal growth-factor (EGF), which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 14 (HMG-14) 7A3C76D4036EA3EA rara_mouse Retinoic acid receptor alpha Rara Nr1b1 Nuclear receptor subfamily 1 group B member 1 protein protein mouse Mus musculus Mouse MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP DIP protein P11416 original sequence version: 140 726F7799633A85AD rara-rps6ka5 1 Msk1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Rara 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-7011027: original sequence: 369-369 : LKVYVRKRRPSRPHMFPKML phosphorylation phosphorylation reaction phosphorylation f3c f2b mint ddr1-rara 1 Cak 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Rara 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-7011035: original sequence: 77-77 : SSEEIVPSPPSPPPLPRIYK phosphorylation phosphorylation reaction phosphorylation f3c f2b mint rara-rps6ka5-1 2 Msk1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Rara 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f9f mint