MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phosphorylation of the Saccharomyces cerevisiae Grx4p glutaredoxin by the Bud32p kinase unveils a novel signaling pathway involving Sch9p, a yeast member of the Akt / PKB subfamily. Phosphorylation of the Saccharomyces cerevisiae Grx4p glutaredoxin by the Bud32p kinase unveils a novel signaling pathway involving Sch9p, a yeast member of the Akt / PKB subfamily. FEBS J. (1742-464X) 2008 imex curation Peggion C., Lopreiato R., Casanova E., Ruzzene M., Facchin S., Pinna LA., Carignani G., Sartori G. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Peggion C., Lopreiato R., Casanova E., Ruzzene M., Facchin S., Pinna LA., Carignani G., Sartori G. FEBS J. (1742-464X) 2008 Only protein-protein interactions imex curation Phosphorylation of the Saccharomyces cerevisiae Grx4p glutaredoxin by the Bud32p kinase unveils a novel signaling pathway involving Sch9p, a yeast member of the Akt / PKB subfamily. Phosphorylation of the Saccharomyces cerevisiae Grx4p glutaredoxin by the Bud32p kinase unveils a novel signaling pathway involving Sch9p, a yeast member of the Akt / PKB subfamily. FEBS J. (1742-464X) 2008 imex curation Peggion C., Lopreiato R., Casanova E., Ruzzene M., Facchin S., Pinna LA., Carignani G., Sartori G. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Peggion C., Lopreiato R., Casanova E., Ruzzene M., Facchin S., Pinna LA., Carignani G., Sartori G. FEBS J. (1742-464X) 2008 Only protein-protein interactions imex curation glrx4_yeast Monothiol glutaredoxin-4 GRX4 SYGP-ORF64 YER174C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAKGPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQHALQ 86B4C4993545B5B2 86B4C4993545B5B2 bud32_yeast EKC/KEOPS complex subunit BUD32 YGR262C BUD32 LDB14 piD261 Low-dye-binding protein 14 Atypical serine/threonine protein kinase BUD32 Bud site selection protein 32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG D12E97BAE21B3385 D12E97BAE21B3385 sch9_yeast Serine/threonine-protein kinase SCH9 YHR205W SCH9 KOM1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMNFFTSKSSNQDTGFSSQHQHPNGQNNGNNNSSTAGNDNGYPCKLVSSGPCASSNNGALFTNFTLQTATPTTAISQDLYAMGTTGITSENALFQMKSMNNGISSVNNNNSNTPTIITTSQEETNAGNVHGDTGGNSLQNSEDDNFSSSSTTKCLLSSTSSLSINQREAAAAAYGPDTDIPRGKLEVTIIEARDLVTRSKDSQPYVVCTFESSEFISNGPESLGAINNNNNNNNNNQHNQNQHINNNNENTNPDAASQHHNNNSGWNGSQLPSIKEHLKKKPLYTHRSSSQLDQLNSCSSVTDPSKRSSNSSSGSSNGPKNDSSHPIWHHKTTFDVLGSHSELDISVYDAAHDHMFLGQVRLYPMIHNLAHASQHQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATPLSPAMQAKFAGFTFVDESAIDEHVNNNRKFLQNSYFMEPGSFIPGNPNLPPDEDVIDDDGDEDINDGFNQEKNMNNSHSQMDFDGDQHMDDEFVSGRFEI BA84BE0F27143AB5 grx4-bud32 2 GRX4p 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BUD32p 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A homomint mint bud32-sch9 1 BUD32p 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SCH9p 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F7A homomint mint bud32-grx4-9 1 GRX4p 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BUD32p 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F8B homomint mint