MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Towards understanding the nitrogen signal transduction for nif gene expression in Klebsiella pneumoniae. Towards understanding the nitrogen signal transduction for nif gene expression in Klebsiella pneumoniae. FEBS J. (1742-464X) 2008 imex curation Glöer J., Thummer R., Ullrich H., Schmitz RA. Only protein-protein interactions klepn Klebsiella pneumoniae pull down pull down predetermined predetermined participant predetermined Glöer J., Thummer R., Ullrich H., Schmitz RA. FEBS J. (1742-464X) 2008 Only protein-protein interactions imex curation nifl_klepn Nitrogen fixation regulatory protein nifL protein protein klepn Klebsiella pneumoniae MTLNMMLDNAVPEAIAGALTQQHPGLFFTMVEQASVAISLTDARANITYANPAFCRQTGYSLAQLLNQNPRLLASSQTPREIYQEMWQTLLQRQPWRGQLINQARDGGLYLVDIDITPVLNPQGELEHYLAMQRDISVSYTLEQRLRNHMTLMEAVLNNIPAAVVVVDEQDRVVMDNLAYKTFCADCGGKELLVELQVSPRKMGPGAEQILPVVVRGAVRWLSVTCWALPGVSEEASRYFVDSAPARTLMVIADCTQQRQQQEQGRLDRLKQQMTAGKLLAAIRESLDAALIQLNCPINMLAAARRLNGEGSGNVALDAAWREGEEAMARLQRCRPSLELESNAVWPLQPFFDDLYALYRTRFDDRARLQVDMASPHLVGFGQRTQLLACLSLWLDRTLALAAELPSVPLEIELYAEEDEGWLSLYLNDNVPLLQVRYAHSPDALNSPGKGMELRLIQTLVAYHRGAIELASRPQGGTSLVLRFPLFNTLTGGEQ Required for the inhibition of nifA activity in response to oxygen and low level of fixed nitrogen mint 127DF145BB1C1957 q9za65_klepn glnK protein protein klepn Klebsiella pneumoniae MKLVTVVIKPFKLEDVRERLSSMGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVVDVISKAAYTGKIGDGKIFVAELQRVIRIRTGESDEAAL mint D7AF705BD20DC078 nifa_klepn Nif-specific regulatory protein nifA protein protein klepn Klebsiella pneumoniae MIHKSDSDTTVRRFDLSQQFTAMQRISVVLSRATEASKTLQEVLSVLHNDAFMQHGMICLYDSQQEILSIEALQQTEDQTLPGSTQIRYRPGEGLVGTVLAQGQSLVLPRVADDQRFLDRLSLYDYDLPFIAVPLMGPHSRPIGVLAAHAMARQEERLPACTRFLETVANLIAQTIRLMILPTSAAQAPQQSPRIERPRACTPSRGFGLENMVGKSPAMRQIMDIIRQVSRWDTTVLVRGESGTGKELIANAIHHNSPRAAAAFVKFNCAALPDNLLESELFGHEKGAFTGAVRQRKGRFELADGGTLFLDEIGESSASFQAKLLRILQEGEMERVGGDETLRVNVRIIAATNRHLEEEVRLGHFREDLYYRLNVMPIALPPLRERQEDIAELAHFLVRKIAHSQGRTLRISDGAIRLLMEYSWPGNVRELENCLERSAVLSESGLIDRDVILFNHRDNPPKALASSGPAEDGWLDNSLDERQRLIAALEKAGWVQAKAARLLGMTPRQVAYRIQIMDITMPRL mint Required for activation of most nif operons, which are directly involved in nitrogen fixation F35B8511E580E5EB nifa-glnk 1 nifA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Gly87Val mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V Tue Jul 12 10:14:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:02:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly87val' Tue Jun 30 16:48:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly87Val' range MINT-7010018: original sequence: 87-87 : ISKAAYTGKIGDGKIFVAEL physical association physical association F3A mint nifa-glnk-1 1 nifA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala43Gly mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Tue Jul 12 10:15:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:12:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala43gly' Tue Jun 30 16:03:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala43Gly' range MINT-7010028: original sequence: 43-43 : VKGFGRQKGHAELYRGAEYS physical association physical association F3A mint nifa-glnk-2 1 glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala49Thr mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T Tue Jul 12 10:15:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:17:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala49thr' Tue Jun 30 18:48:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala49Thr' range MINT-7010038: original sequence: 49-49 : QKGHAELYRGAEYSVNFLPK nifA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A mint nifa-glnk-3 1 nifA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Arg103Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R S Tue Jul 12 10:55:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:15:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg103ser' Tue Jun 30 19:01:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg103Ser' range MINT-7010055: original sequence: 103-103 : VAELQRVIRIRTGESDEAA physical association physical association F3A mint nifa-glnk-4 1 glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Asp108Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D G Tue Jul 12 10:15:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:39:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp108gly' Tue Jun 30 16:06:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp108Gly' range MINT-7010070: original sequence: 108-108 : RVIRIRTGESDEAA nifA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A mint nifl-glnk 1 glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Gly87Val mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V Tue Jul 12 10:24:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:31:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly87val' Tue Jun 30 18:37:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly87Val' range MINT-7010083: original sequence: 87-87 : ISKAAYTGKIGDGKIFVAEL nifL 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint nifl-glnk-1 1 nifL 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala49Gly mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Tue Jul 12 10:24:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:26:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala49gly' Tue Jun 30 17:35:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala49Gly' range MINT-7010133: original sequence: 49-49 : QKGHAELYRGAEYSVNFLPK physical association physical association F3B mint nifl-glnk-2 1 nifL 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala43Gly mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Tue Jul 12 10:22:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:57:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala43gly' Tue Jun 30 18:25:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala43Gly' range MINT-7010145: original sequence: 43-43 : VKGFGRQKGHAELYRGAEYS physical association physical association F3B mint nifl-glnk-3 1 nifL 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glnK 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Arg103Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R S Tue Jul 12 10:22:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:19:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg103ser' Tue Jun 30 16:31:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg103Ser' range MINT-7010161: original sequence: 103-103 : VAELQRVIRIRTGESDEAA physical association physical association F3B mint