MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Biochemistry (0006-2960) 2008 mimix curation Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci Biochemistry (0006-2960) 2008 mimix curation mimix curation Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Biochemistry (0006-2960) 2008 mimix curation Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci mimix curation in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci Biochemistry (0006-2960) 2008 mimix curation mimix curation Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination. Biochemistry (0006-2960) 2008 mimix curation Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci mimix curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bezsonova I., Bruce MC., Wiesner S., Lin H., Rotin D., Forman-Kay JD. SH3 suggested by mcarducci Biochemistry (0006-2960) 2008 mimix curation mimix curation cblb_human E3 ubiquitin-protein ligase CBL-B Signal transduction protein CBL-B SH3-binding protein CBL-B Casitas B-lineage lymphoma proto-oncogene b RING finger protein 56 CBLB RNF56 Nbla00127 RING-type E3 ubiquitin transferase CBL-B protein protein human Homo sapiens Human MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL B4E307D31B9F0779 sh3k1_human SH3 domain-containing kinase-binding protein 1 SH3KBP1 CIN85 Cbl-interacting protein of 85 kDa Human Src family kinase-binding protein 1 CD2-binding protein 3 protein protein human Homo sapiens Human MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK 3BD350FCDB14BD4C ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV B6E7BC06FEE77196 sh3kbp1-ubc 3 CIN85 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Ubiquitin 6 unspecified role unspecified role neutral component neutral component P0CG48:p.Lys6Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:19:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:15:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys6glu' Tue Jun 30 19:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys6Glu' direct interaction direct interaction homomint mint t1 f1a f1b f2a f2b f4a f4b f4c f4d f6 sh3kbp1-ubc-1 3 CIN85 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Ubiquitin 6 unspecified role unspecified role prey prey direct interaction direct interaction homomint mint f1c f2d sh3kbp1-ubc-2 3 Ubiquitin 6 unspecified role unspecified role prey prey CIN85 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint f1d f2c cblb-sh3kbp1-3 2 CBL-B 4 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CIN85 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f6 homomint mint Ubiquitin competes with Cbl for CIN85 binding. ubc-sh3kbp1 1 Ubiquitin 6 unspecified role unspecified role bait bait his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CIN85 5 unspecified role unspecified role prey prey flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f7a homomint mint