MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis of PxxDY motif recognition in SH3 binding. Structural basis of PxxDY motif recognition in SH3 binding. J. Mol. Biol. (0022-2836) 2008 mimix curation Aitio O., Hellman M., Kesti T., Kleino I., Samuilova O., Pääkkönen K., Tossavainen H., Saksela K., Permi P. SH3 suggested by mcarducci mimix curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Aitio O., Hellman M., Kesti T., Kleino I., Samuilova O., Pääkkönen K., Tossavainen H., Saksela K., Permi P. SH3 suggested by mcarducci J. Mol. Biol. (0022-2836) 2008 mimix curation mimix curation Structural basis of PxxDY motif recognition in SH3 binding. Structural basis of PxxDY motif recognition in SH3 binding. J. Mol. Biol. (0022-2836) 2008 mimix curation Aitio O., Hellman M., Kesti T., Kleino I., Samuilova O., Pääkkönen K., Tossavainen H., Saksela K., Permi P. SH3 suggested by mcarducci mimix curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Aitio O., Hellman M., Kesti T., Kleino I., Samuilova O., Pääkkönen K., Tossavainen H., Saksela K., Permi P. SH3 suggested by mcarducci J. Mol. Biol. (0022-2836) 2008 mimix curation mimix curation es8l1_human Epidermal growth factor receptor kinase substrate 8-like protein 1 EPS8L1 DRC3 EPS8R1 PP10566 Epidermal growth factor receptor pathway substrate 8-related protein 1 protein protein human Homo sapiens Human MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLLLLVCQEPERAQPDVHFFQGLRLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLIVNEELQARLAQGRSGPSRAVPGPRAPEPQLSPGSDASEVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEGEVEMEVI mint Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton E55F71B6E128151E cd3e_human T-cell surface glycoprotein CD3 epsilon chain CD3E T3E T-cell surface antigen T3/Leu-4 epsilon chain protein protein human Homo sapiens Human MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI A1603D01CE9957D7 eps8l1-cd3e-2 1 EPS8L1 3 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CD3 epsilon 4 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t1 f2 f4 f6 eps8l1-cd3e-3 2 EPS8L1 3 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CD3 epsilon 4 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3 homomint domino mint