MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Regulation of contractile vacuole formation and activity in Dictyostelium. Regulation of contractile vacuole formation and activity in Dictyostelium. EMBO J. (0261-4189) 2008 imex curation Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. 2009-02-12 Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation Regulation of contractile vacuole formation and activity in Dictyostelium. Regulation of contractile vacuole formation and activity in Dictyostelium. EMBO J. (0261-4189) 2008 imex curation Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. 2009-02-12 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation tbc12_dicdi Drainin phgA DDB_G0269130 TBC1 domain family member 12 homolog protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MICFDNSTAHTDSNNNNNQCDLPENYKELVTTGKVEKLILSPSSSLDRPKTLPPKSQEEVLKHQREYEEIQRKAKKTLEREAKEKEKLDAIRKEKERSLIDARKVWEEDIIPVWEKNSKKRDIKKIKDLSWRGLPPAVRGKIWRLCIGNDLRVTDELFNIFLGHANNAYNKTTSPPLKSSLSSSSKSPNINIDLRQANNSIHHSRSPMNTSTDGEDDVLDLETTNMALILQDIQDTFPSLMIFQKGGPLHSDLIDVLGAYICYRPDIGYVPGMTFLAAMFLLNMEKCDAFLSLSNHINSVCFLPFFRQDQSGIPKYLAAMDSTVEALTPPLHKHFKEIGISAKNYLVDWITTLFSKALPLDVATRIWDLVFIEGEIFIYRTALSILRYFISDLIQATYDECIDLFNKLPQRKISEDKLFEEIQSIVLDQRKFDKLLEK May act as a GTPase-activating protein for Rab family protein(s) (By similarity). Required for osmotic regulation by the contractile vacuole in hypo-osmotic environments. Essential for periodic fusion of the contractile vacuole with the plasma membrane and consequent expulsion of water from the cell body mint B02FA4DA7B9F3B08 rab8a_dicdi Ras-related protein Rab-8A rab8A sas1 sasA GTP-binding protein SAS1 DDB_G0280043 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTSPATNKSAAYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGNIRNWIRNIEQHATDSVNKMLIGNKCDMAEKKVVDSSRGKSLADEYGIKFLETSAKNSINVEEAFISLAKDIKKRMIDTPNEQPQVVQPGTNLGANNNKKKACC mint Protein transport. Probably involved in vesicular traffic BF681EF5C810019E rab14_dicdi Ras-related protein Rab-14 Rab4-like GTPase rab14 rab4 rabD DDB_G0281337 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSFPYEYIFKYIIIGDMGVGKSCLLHQFTENKFVPDSPHTIGVEFGTRIVDVNNKKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDITRRITYNHLTTWLTDARNLTNPNTVIMLIGNKKDLEGQRDVTYEEASAFAKQNGLIFVESSAKTGENVEEAFLRTAKLIFQSVQEGNVDLIPDGGITKNPPQTITDKPQDASKCSC Regulates the fusion of phagosomes and lysosomes mint 28FF9504B3A32AB6 q54iz7_dicdi DDB0187927 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MESSTEPNLPLKAESASIGISITDTCNTTNLTSNNNNNNNNNNNNNNNNNPNNNNNNNPNNNNNNNPNNNNNKNNPNNKNNNLIVDNIVDYNNLTVSPLPLNRSRSNSMNSGPTVHVISSTTGRGRSSSMSNNSMVINQPCGSTITTTNINSNTNNNSSSSSSSSNSYYNYFSRKSKNNKKIKVPSSPESIGGMGIMGGGIEGGDKYSFVLTASPSPNTYFNNNSVNNNLANFSLTDEGYLDTIAHENLKDPATLIRQREISSEWTSKIIPTNCTTDQARKNLKALIRKGIPDKKRNLVWKAIIGTNEADQTHCYNSAYSSSFGDESDPNIRNIPAFGGLFSPSDHLITEQGVKQVKSILNLIHTNSHVEYCPQISDLVHILISFMSEANTYTTTSLILKDAEENRPHRFLNIDKKECAKFVHSFDHLIELHLPKLHRHMITIGLTNSFVFSDEWFSRLFVSFLPYNTVLRIFDILLNEGYKVLYRIGLALLKTHKKQLKKQKDIEKFLSTLNKLNLQMFDADALIKVAFESISLKRSHLEDINDKQNHKVKDVPEPAPIYYRSKITIPSVILNSDDFELIWAWLPPRLSVATPRKLFNSVTDGNNVRLLFESLVEHTCILVVLKSDNGSIFGFYSDSEVQPKFGFGDRNVFLFTLKPHVHVYKPTEKNQLYTSFKEQSISIGHSNLGEIGLFIGADLNGKTGATETFGNPCLNDKDQHTFQTIVLEAFTIEQ mint A8484E8F615DD104 rb11a_dicdi Ras-related protein Rab-11A rab11A rab11 DDB_G0269238 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTSKGSQEEYDYLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAGQERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLRHLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQNILTQIYHIMSRPSHSTGPQTTIDSNTETIILPTTSEPPAAKSGCC Required for normal contractile vacuole structure and function. Cells expressing a dominant negative rab11A exhibit a more extensive contractile vacuole network and enlarged contractile vacuole bladders. These cells exhibit a functional defect in osmotic regulation where cells immersed in water become rounded and detach from the surface, and contain swollen contractile vacuoles mint 6A82CA65688B5FE0 rb11c_dicdi Ras-related protein Rab-11C rab11C DDB_G0277101 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MPQEEEAEYLFKIVIIGDSAVGKSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAGQERFRAVTSGYYRGAVGAMIVYDITSKISFKNVTRWLNELREMAEQDILIMMVGNKSDLEMSREVPTKEAQAFAESNKISFLETSALNSTNVNQSFERLLTDIYHLVSSKKPMVVDDTQNWLVPNQGKKLTPLSDPAPQLTANTTSTHQEKKSGCC mint BB12CF69DFE3216B q54iz7-rab11a 1 rab11A 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined disgorgin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a mint q54iz7-rab8a 1 rab8A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined disgorgin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a mint q54iz7-rab11c 1 disgorgin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab11c 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a mint phga-rab11a 1 Drainin 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab11A 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5e mint rab14-phga 2 rab14 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Drainin 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b mint rab11a-phga 2 Drainin 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAB11A 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b mint rab11a-q54iz7 2 rab11A 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined disgorgin 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b mint rab8a-q54iz7 2 rab8A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined disgorgin 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b mint