IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11. Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11. J. Biol. Chem. (0021-9258) 2008 imex curation Kondas K., Szlama G., Trexler M., Patthy L. patthy@enzim.hu 2009-07-13: Institute of Enzymology, Biological Research Center, Hungarian Academy of Sciences, Budapest, Hungary Mature mouse myostatin and mature human GDF11 were purchased fromR&D Systems. WFIKKN1 and WFIKKN2 were expressed in drosophila S2 cells and subsequently purified. The fragments of the proteins were expressed in Pichia pastoris. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kondas K., Szlama G., Trexler M., Patthy L. patthy@enzim.hu. patthy@enzim.hu Accepted 2009-AUG-16 by ORCHARD. 2009-07-13: Institute of Enzymology, Biological Research Center, Hungarian Academy of Sciences, Budapest, Hungary Mature mouse myostatin and mature human GDF11 were purchased fromR&D Systems. WFIKKN1 and WFIKKN2 were expressed in drosophila S2 cells and subsequently purified. The fragments of the proteins were expressed in Pichia pastoris. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation wfkn1_human WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 WFIKKN1 GASP2 WFIKKN Growth and differentiation factor-associated serum protein 2 PSEC0040 C16orf12 WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing protein protein protein human Homo sapiens Human MPALRPLLPLLLLLRLTSGAGLLPGLGSHPGVCPNQLSPNLWVDAQSTCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDIWDGQPVCRCRDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTARPTPGAAPVPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQMYGNVVVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDAAPSIPAPAECLPDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQACARGPGDACVLPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPPCRACRLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTKYLEVTLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQACELLNRFQD 72BB28708D3EFB1F gdf8_mouse Growth/differentiation factor 8 Mstn Gdf8 Myostatin protein protein mouse Mus musculus Mouse MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 3E19814DD62C08BE wfkn2_human WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 WFIKKN2 GASP1 WFIKKNRP WFIKKN-related protein Growth and differentiation factor-associated serum protein 1 UNQ9235/PRO31996 WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing-related protein protein protein human Homo sapiens Human MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQSTCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNTSPPPPETTMHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPEITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLKDEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH 08B4F2EDBE121F81 gdf11_human Growth/differentiation factor 11 GDF11 BMP11 Bone morphogenetic protein 11 protein protein human Homo sapiens Human MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAAAGVGGERSSRPAPSVAPEPDGCPVCVWRQHSRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLRPVPRPATVYLQILRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS E8FF48E363635BA8 mstn-wfikkn1 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey ntr region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain fs region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris physical association physical association Table 1 and 2 WFIKKN1 Binds Myostatin Primarily through Its Follistatin Domain Exact FS domain and NTR region of human WFIKKN1 not given in the text so has been inferred from the UniProtKB entry. mstn-wfikkn2 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association the affinity of WFIKKN1 for myostatin is lower than that of WFIKKN2; the Kd value for binding of WFIKKN2 to myostatin (Fig. 2C) Table 1 gdf11-wfikkn2 1 4 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 unspecified role unspecified role bait bait physical association physical association table 1 Both WFIKKN1 and WFIKKN2 Bind GDF11 with High Affinity gdf11-wfikkn1 1 5 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Both WFIKKN1 and WFIKKN2 Bind GDF11 with High Affinity table 1